Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G130121-GRMZM2G162968
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100193235

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1314412115167
Log2 mRNA fold difference:-2.6075824562509
Log2 TE fold difference:1.4789450966916
Sequences
Protein sequence

MGALIAGAKYRGEFEDRLKAVLKEVTDSDGQTVLFIDEIHTVVGAGATNGAMDAGNLLKP
MLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVFVDQPSVEDTISILRGLRERYELHH
GVRISDSALVAAAVLSDRYISGRFLPDKAIDLVDESAAKLKMEITSKPTALDEIDRAVLK
LEMERLSLTNDTDKASRDRLSRLEAELSLLKDKQRQLTEQWEHEKAVMTKIQSIKEEIDR
VNVEIQQAEREYDLNRAAELKYGSLNALQRQLQATEKELDEYQSSGKSMLREEVTQDDIA
EIVSRWTGIPVSKLKQSDREKLLYLEDELHKRVVGQDPAVKAVAEAIQRSRAGLSDPNRP
IASFMFMGPTGVGKTELAKALAAFMFNTEEAVVRIDMSEYMEKHSVSRLIGAPPGYVGYE
EGGQLTEAVRRRPYSVVLFDEIEKAHSDVFNVFLQILDDGRVTDSQGRKVSFTNTIIIMT
SNVGSQYILNMDEEVGSSDSAYENIKRRVMDAARSVFRPEFMNRVDEYIVFKPLEREQIN
SIVKLQLARVQKRIADRKIKLEVSPGAIEFLGSLGYDPNYGARPVKRVIQQHVENELAKG
ILRGDFKDEDSIFVDTQVTVPSNGQLPQQKLVFRKVGEQSKPAAEGEKFLPAV*

MAAAPPLSADVLSFLTSAPAAPTPVVAAAWGAARAGPVRGKAALRTTRGGRGGVLAPLVG
RRPRRTPLSVRCNATSRDGRITQQEFTEMAWQAIVSSPEVAKESKHQIVETEHLMKSLLE
QRNGLARRIFSKAGVDNTRLLDATKKFIQRQPKVLGEEPGSMLGRDLEALIQRARDFKKE
YGDSYVSVEHLVLGFAEDKRFGTQLFKDFQITVKTLKSAIESIRGKQNVIDQDPEGKYEA
LDKYGKDLTAMARQGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAIAEGLA
QRIVQGDVPQALTNRRLIALDMGALIAGAKYRGEFEDRLKAVLKEVTDSDGQTILFIDEI
HTVVGAGATNGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDPALERRFQQVYVDQ
PSVEDTISILRGLRERYELHHGVRISDSALVAAAVLSDRYISGRFLPDKAIDLVDESAAK
LKMEITSKPTALDEIDRAVLKIEMERLSLTNDTDKASKDRLSRLEAELSLLKDKQRQLTE
KWEHEKSVMTKIQSIKEEIDRVNVEIQQAEREYDLNRAAELKYGSLNALQRQLQTTEKEL
DEYQSSGKSMLREEVTQDDIAEIVSRWTGIPVSKLKQSDREKLLYLEEELHKRVVGQDPA
VKAVAEAIQRSRAGLSDPNRPIASFMFMGPTGVGKTELAKALASFMFNTEEAVVRIDMSE
YMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVVLFDEIEKAHLDVFNVFLQILDD
GRVTDSQGRKVSFTNSIIIMTSNVGSQYILNMDEEDGSSDSAYENIKRRVMDAARSVFRP
EFMNRVDEYIVFKPLEREQINSIVKLQLARVQKRIADRKIKLDVSPGAIEFLGSLGYDPN
YGARPVKRVIQQYVENELAKGILRGDFKDEDSIFVDTQVTVPSNGQLPLRKLVFQKVGEQ
SKPAAEGEKFLPAV*

Other information
Ka divergence:0.107332KaKs divergence:0.266667
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1962Length 2 (bp):2925Length divergence:0.197
MFE 1 (kcal):-637.8MFE 2 (kcal):-988.1MFE divergence0.215