Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G130224-GRMZM2G306094
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100193582

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.64326448962179
Log2 mRNA fold difference:-0.98721526861346
Log2 TE fold difference:0.31931917019183
Sequences
Protein sequence

MRAAVNSPPPHCYSRRRASATLLDARHVFDHVPQQRLPNLAAGLRARPVAAAAWRPARRS
AASAAARTCGTVSAPRLFRTFLQIPTSSSSAYRALVASSAFLPSRRSFEGYIPRSCSSSS
LQIYSRSPLLNLSPSSALMVSSQLTGSSDVAQRSEEWFALRKDKLTTSTFSTALGFWAGN
RRPELWNEKVFGATEIKLADAARSAMDWGTHHESVAIEQYTSITGRPVGTLGFAVHTEAS
FGWLGASPDGVLGCEPHDGILEVKCPFNKGKPELALPWRAMPYYYMPQVQGLMEILGRDW
VDLYCWTPNGSSLFRVPRDCAYWELIHEALRDFWWGNVVPARELALLGKDDEARSFEPQP
KHRLTNLVLYRSRKLASEAKLLCMDVGGHVEFFQ*

MRAAVNTPPPRCYSRRRASATLLEARYVFDHVPQRRLPSLAAELRARPASVAARRPARRS
AASAAAPTCGAASVTRLFRALLQIPTAYSSISRVRLAPAAFLPARYNFEGYIPRSCSSSL
QIYSRSSMLNLPPSSALTVSSQLTSSDVAQRSEEWFALRKDKLTTSTFSTALGFWAGNRR
AELWNEKVFGATETKLADTARSAMDWGTHHESVAIEQYTNITGRHVGTFGFAVHAEASSG
WLGASPDGVLGCGLDGGILEVKCPFNKGKPELALPWRAMPYYYMPQVQGLMEIMGRDWAE
LYCWTPSGSSLFRVPRDRAYWELLHEALRDFWWGDVVPARELALLGKHDEARSFEPRPKH
RLTNLVLYRSRKLASEAKLLWMDVGGRVEFFQ*

Other information
Ka divergence:0.114365KaKs divergence:0.153666
GC content 1 (%):62GC content 2 (%):64GC content divergence:0.016
Length 1 (bp):1185Length 2 (bp):1179Length divergence:-0.003
MFE 1 (kcal):-508.5MFE 2 (kcal):-554.6MFE divergence0.043