Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G130374-GRMZM2G173680
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216719
Function (paralog2):hypothetical protein LOC100191630

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.9347256532663
Log2 mRNA fold difference:3.2106167697878
Log2 TE fold difference:-1.3068498599199
Sequences
Protein sequence

MEEVEVANRAAVESCHRVLALLSQQRDPALLKSVASETAEACAKFRKVAALLGSGVGHAR
GRFSRRVRPLGLVGHKSPVGSGGNNPVEMLPSAAAVTSPSPSTSYPPQMRARLNGVPDPR
GLDMACSSSSKSGGVGGGGAHPFGGAPKLVQPLSVQFQIGNVAHRYPFHQQPPSRQKLQA
AEMFRRSSSGTISLKFDSPIPSGGGGAAGTVSFVSSLSMDGSVGVASLDGKRPFHLVGTP
VAASDTAADAHRAPKRRCTCRGGEEDGRGNKCGTSGRCHCSKRRKLRIKRSIKVPAISNK
VADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVDDPAMLIVTYEGE
HGHTQLPAQPSTQT*

MEEVEVANMAAVESCHRVLALLSQQQDPALLKSVASETAEACAKFRKVAALLGSASGGGG
CGHARGRFSRRVRPLGLVNQKSPLGIATGSGNPLEMMPSTAAAAGSPSPPQSTSYAQMRA
RLSSAPESSRGLDLACSSSRCSPHPFGAPKLVQPLSVQFQIGSVAHRYPFHQQQSRQKLQ
AEMFRRSNSGISLKFDSPSPSGGAAGTMSSARSFMSSLSIDRSMASLDGKRPFHLVGTPV
ASDPADAHRAPKRRCTGRGEDGRGKCATTGRCHCSKRRKLRIKRSIRVPAISNKIADIPP
DEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVDDPAMLIVTYEGEHSHTQL
PAQPAQT*

Other information
Ka divergence:-0.133564KaKs divergence:0.0950985
GC content 1 (%):67GC content 2 (%):60GC content divergence:-0.055
Length 1 (bp):1125Length 2 (bp):1104Length divergence:-0.009
MFE 1 (kcal):-545MFE 2 (kcal):-481.7MFE divergence-0.062