Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G130398-GRMZM2G008623
Species:maize
Duplication type:WGD
Function (paralog1):proteasome subunit alpha type 3
Function (paralog2):hypothetical protein LOC100383475

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSSIGTGYDLSVTTFSPDGRVFQVEYATKAVDNSGTIVGIKCKDGIVLGVEKLVTSKMML
EGSNRRIHSVHRHSGLAVAGLAADGRQIVSRTKSEAASYEKTRVYGEPISVKELADRVAS
YVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGVSYKYFGAALGKGRQAAKTEIEK
LKLSELTCREGIVEVAKIIYGVHDEAKDKAFELELSWICDESNRQHQKVPNELLEQAKAA
AQAALEEMDAD*

MSSIGTGYDLSVTTFSPDGRVFQVEYATKAVDNSGTVVGIKCKDGIVLGVEKLVTSKMML
EGSNRRIHSVHRHSGLAVAGLAADGRQIVSRTKSEAASYEKVYGEPIPVKELADRVASYV
HLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGVSYKYFGAALGKGRQAAKTEIEKLK
LSELTCREGIVEVAKIIYGVHDEAKDKAFELELSWICDESNHQHQKVPNELLEHAKAAAQ
AALEEMDAD*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):756Length 2 (bp):750Length divergence:-0.004
MFE 1 (kcal):-256.42MFE 2 (kcal):-251.82MFE divergence-0.009