Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G130477-GRMZM2G453078
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276972
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-5.154668962871
Log2 mRNA fold difference:-4.0283761231023
Log2 TE fold difference:-0.93137675433874
Sequences
Protein sequence

MALLRALRRALPALSSPAAVLPRRAPHPLPPPPAPRRFLDPIGLRSFSAAAATASQAPPM
GATLFGGLMDTRFPKRRPGFANRRKRASLRPKGPYYWVKCKPDEPIPVSQPNQGSVRGRK
EKKRIKQRKDFIMAEKKKRRAQYSAAVKRKEAERTERKMAAVARERAWAARLIELKQIEE
DVKAVMA*

MGATLFGGLTESRFAKRRPGFADRRKRASLRAEGPPYRVKCEPDEPVPASQPNQGSVRVR
GRKDRKRIKQRDDFITAEKEKRRAQYSAAVKRKEAERTEREMAAVARDRAWAERLVELKQ
LEEEKNTAMA*

Other information
Ka divergence:0.499277KaKs divergence:0.639676
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):564Length 2 (bp):393Length divergence:-0.179
MFE 1 (kcal):-225.7MFE 2 (kcal):-143.5MFE divergence-0.223