Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G130800-GRMZM5G875864
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191481
Function (paralog2):hypothetical protein LOC100192092

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.32006109294231
Log2 mRNA fold difference:-0.69148943643297
Log2 TE fold difference:0.23593010057877
Sequences
Protein sequence

MGMDAGGGKLPYSYPAHQDGKLVKSFSRVEPRKFGLALVAGFLLVTCAYFSTAKFDAIHV
AMTVSPVSGNAAGIGPLVGAANADTSDSKQRLDLGKQDPDDALSRSEEEEGSRADEVLEK
DDGKASSSSGTDSGSNAPLEDTRRDETFVGDSGGASSAAGARSEAVPARHEHDDDAPAAA
LLPPVTSEGAANSTQGSGVLEDEELQVQDAVANPSKRSNDSAATRSSSSGRSPSVVHSDP
AILPAPSQQIAPAAPQEADKALAVQHIPAIPEVKQSDSETPAREWKPLCDITSNRRIDWC
ELDGDVRVLGANASVTLVAPPGGADGRTFRAESWRIKPYPRKADPNAMRVVRVLTVRSVP
GEAPACTDRHGVPALVFSDRGYTGNYFHAFTDVILPLFLTARQYAGEVRLLVTDLQAWWV
GKFAPVFRSISNYELVDLDRDPRVHCFRHVQVGLTSHDDFSIDPRRAPNGYSMLDFTGFM
RAAYGLPRGDVAAAAGPSSKRRPRLLLIARARTRRFVNAEEIVRGAEKLGFEVVVSEGTH
EVAPFAELANSCDAIMGVHGAGLTNMVFVPTGGVVIQVVPLGGLEFVAGYFRGPSRDMGL
RYLEYRITPEESTLINQYPRDHPIFTDPNGIKSKGWESLKDAYLDKQDVSLDMKRFRPTL
KKAIAHIRKARAKANAGGGGNN*

MGMDAGGGKLPYSYAGQQDGGKLVKSVSRVEPRRFGLGLVAGFLLVTCAYFSTAKFDAIQ
IAMTSRPVSSNAGGVGVGSLEVGGVVAAADTYNASRQGLDLGKKGPGATSMADEGSEAEA
LEKDGGKASSPSGPGVPAALLPPVSSEEAANSTLESGVKATTQPPTASFTAISGLEDEEL
QVQDAVASGSKRSKDSAAAAAATRSANVSSPSVVHSHHAILPAPAQRIPEVKQADSETTP
AREREWKPLCDVTSNRRIDWCELDGDVRVVGANASVTLVAPPGADNRTFRAESWRIKPYP
RKADPNAMRFVRVLTVRSVASGSGEAACTDGGDDDVPALVFSDRGYTGNYFHAFTDVILP
LFLTARRYAGEVRLLVADLQPWWVGKFLPVFRSISKYELVDLDRDPRVRCFRHVQVGLTS
HADFSIDPRRAPNGYSMLDFTRFMRAAYGLPRGDVVAAAPARRPRLLVVARARTRRFVNT
EEIVRGAEAVGFEAVVSEGTHEVAPFAELANGCDAIMGVHGAGLTNMVFLPTGGVVIQVV
PLGGLEFVAGYFRGPSVDMGLRYLEYRIEPEESTLVDQYPRDHPIFTDPNGIKSKGWESL
KDAYLDKQDVRLDMERFRPTLQEAIAHLRKAKAKANGDGNN*

Other information
Ka divergence:0.053624KaKs divergence:-0.191941
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):2049Length 2 (bp):1926Length divergence:-0.031
MFE 1 (kcal):-1030.11MFE 2 (kcal):-981.86MFE divergence-0.024