Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G130904-GRMZM2G134947
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272764
Function (paralog2):Anionic peroxidase H Fragment

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.1780020213304
Log2 mRNA fold difference:-1.3476830893607
Log2 TE fold difference:2.4144325408049
Sequences
Protein sequence

MEHSLYYYCRSWLLVCSSVLALCLGSRGQLTPGFYRSTCPQLYYTVQRHVFDAMRAEMRM
GASLLRLHFHDCFVNGCDASILLDGDDGEKFALPNRNSVRGFEVIDAIKADLESVCPEVV
SCADIVALAASYGVLFSGGPYYDVLLGRRDGLVANQSGANSGLPSPFEPIDSIIHKFAAV
DLNTTDVVVLSGAHTIGRARCALFSNRLSNFSATESVDPTLDAGLAESLQSLCAGGDGNQ
TSALDVSTPNAFDNAYYKNLLLEKGLLSSDQGLFSSPEGVARTKALVETYSQDSEHFFCH
FASSMIKMGNIPLTASDGEIRKNCRVAN*

MERYSCCRWVLACSILALCLGGQGARCQLTSDFYDSTCPQLYYVVQQHVFDAMREEMRMG
ASLLRLHFHDCFVNGCDASILLDGDDGEKFALPNLNSVRGYEVIDAIKADLESACPEVVS
CADVVALAASYGVLFSGGPYYDVLLGRLDGRVANQSGADNGLPSPFEPVDSIIQKFAAVG
LNTTDVVVLSGAHTIGRARCALFSNRLSNFSATDSADPTLEASLADSLQSLCAGGNGDGN
ETAALDVSSPYVFDNDYYKNLLTERGLLSSDLGLFSSPEGVAASTKDLVEAYSSDGDQFF
YDFVWSMIRMGNIPLAAGSDGEVRKNCRVVN*

Other information
Ka divergence:-0.0468896KaKs divergence:-0.152021
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):987Length 2 (bp):996Length divergence:0.005
MFE 1 (kcal):-418.5MFE 2 (kcal):-438.1MFE divergence0.023