Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G131243-GRMZM2G146623
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100191371
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.80477361668518
Log2 mRNA fold difference:-2.0073554685309
Log2 TE fold difference:1.1911553003053
Sequences
Protein sequence

MGGGTVVCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLF
EADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTV
KRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELL
SYSSFSSSSSSSSSSKEDDRPQALEVVTLACGLVGGDSIQTYLWGSYAAIVAPLTGQAVS
HNALLFLQALLGSVPLVHVEDVCEAHVFCMEQESMAGRFLCAAGYPNMRDMVDHFAAKHP
DLKIQLTQVTGEGVRIQPNTSKLEDLGFRFKYGVEETLDCSVECAKRLGEL*

MGGGTVVCVTGGSGYLGSWLVRKLLGRGCVVHATLRSLADEKKTGLLRALPGAAERLRLF
EADMYDADTFEPAIAGCHFVFLVATPLTHDPTSTKYKNTTEAAVDAARIILRQCALSGTV
KRVIHTASVTAASPLKEDGSGYKDFADESNWTPLNLSYEFTNAYLDDYVRSKTLSEKELL
SYSSFSSSSSSSSL

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:-0.892849
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):1056Length 2 (bp):582Length divergence:-0.289
MFE 1 (kcal):-485.7MFE 2 (kcal):-268.8MFE divergence-0.287