Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G131575-GRMZM2G401040
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194038 (LOC100194038), mRNA
Function (paralog2):ATP synthase F1, delta subunit family protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.071811407541765
Log2 mRNA fold difference:0.23804864339435
Log2 TE fold difference:-0.16308313830179
Sequences
Protein sequence

MNILNLQPINPGGHPAFPAAKESGHLTPASVRFDGVPVPAQSHAHCPRWQAQTLRRDSSY
VGVEHEGTRTTASVPVPVPVPAVAPVPAPFKPLTLDFLRSLMDRSCSMSPAVAEYGEDSA
PPPPQMVALRVVVASAVELDARQTELIARKMRRLTGFVNLKVDNVVDASLLAGFVVRYGT
DDSHVIDLSVKGQLAALQNRVDSIDHQTAHVHGHPHH*

MKILNQPISPGGHLVPAQPSTTAAAGRSHAHCPRWQAQTLRRDSSYVGVEHIDGTTASVP
VPVPVPVAAPFKPLTLDFLRSLLDRNCSMAPAVPDGEASAPPPPQMVALRVLVTSAVELD
ARQAERIARKMRRLTGFVDLKVETAVDASLIAGFVVCYGTDDSHVIDLSVRGQLAALKSR
VDSIDQTAHAHGHPHHH*

Other information
Ka divergence:0.073817KaKs divergence:0.135484
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):654Length 2 (bp):594Length divergence:-0.048
MFE 1 (kcal):-309.2MFE 2 (kcal):-290.3MFE divergence-0.032