Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G131815-GRMZM5G800835
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275748
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.7427780493726
Log2 mRNA fold difference:-2.0591283502898
Log2 TE fold difference:4.8190666945676
Sequences
Protein sequence

FCFFFLSHGGQAVETRETRRTRERKPTGSAAPAHLPHPQKKSRVPPAATTITAMISILAQ
ERLLGFALGSVSIGGFVLHQRRAIYRSIAEADGSPYFYQPGEIASRRSSTELAHVWNKAV
DETLGRLVVYLSSRGW*

MAHERHSRSLRSTNHVTETVDEEDKGQGKESQPPQSRVPPAATTTTAMISILAQERLLGF
ALGSVSMGGFVLHQRRAIYRSIAEADGSSYFYQCKKLHH*

Other information
Ka divergence:-0.310578KaKs divergence:-0.26644
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):411Length 2 (bp):300Length divergence:-0.156
MFE 1 (kcal):-147.16MFE 2 (kcal):-99.6MFE divergence-0.193