Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132009-GRMZM2G519073
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279810
Function (paralog2):hypothetical protein LOC100383256

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.26937915170737
Log2 mRNA fold difference:0.67536848172274
Log2 TE fold difference:-0.42409564303907
Sequences
Protein sequence

MGEPLLASLSMENSNSHPCTLLSMDPAGSHLASAESSGGGSAATNGVGNGVDRELFVIPR
RESAHPVPPDINLPLSADHSPLPPSWSLDTFDILDVTLGTHNYESEVALTLPKPTGNGNG
SAAIGVGARKYAKRGDSIWGAWFFFNNYFKPALVEKSKGKMVRDASRNISGFDKSDLRLD
VFLVQHDMENMYMWVFKERPDNALGKMQLRSFMNGHSKHGEPSFPFSADKGFARSHRMQR
KHYRGLSNPQCLHGIEIVASPNLSAVPESDLKRWAELTGREHNFSVPSEASDFESWRNLP
STDFELDRPHPPAAKSATHGQKKGLNGSGLNLSTPPSSDDGMDLSPKCAKRRKDFFGHGV
EEDCVMANNSCSDREQEAEAHTGEPSWMHEFTGVAKHASGPVTAAKTIYEDEEGYLIVVS
MLFSDPHSVKVSWRNTLTHGIVKITCVSTARMPYIKKHDRTFKLTDPFPEHCPPGEFVRE
IPLATRIPEDAKIEAYYDETGTGLEIMVPKHRVGPEEHEVQVCMRPPHLGDNDLVLS*

MGEPLLTSLSMENSNSHPCTLLSMDPAGSRPASAESSGGGGAATNGVGSGGDRELFIVPR
RESAHPGPPDINLPLSADPLPPPPSWSLDTFDILDVTLGTHNYESEVALTLPKSTGNGNG
SATATVSVGTRKCAKRGDSIWGAWFFFNHYFKPALVEKPKGKVTRDASGSISGFDKSDLR
LDVFLVQHDMENMYMWVFKERPDNALGKMQLRSFMNGHSKHGEPSFPFSADKGFSRSHRM
QRKQYRGLSNPQCLHGIEIVGSPNLSAVPDADLKRWAELTGRELNFSIPSEASDFEAWRN
LPSTDFELDRPHPPAAKSATHGSHSHKKGLNGSGLNLSTPPSSDDGMDLSPKCAKRRKGF
FGHGVEEDCVMANNSCSDREQEVEAHAGEPSWMHEFTGVAKHASGPVTAAKTIYEDEEGY
LIVVSMLFSDPHSVKVSWRNTLTHGIVKITCVSTARMPYIKRHDRTFKLTDPSPEHCPPG
EFVREIPLATRIPEDAKIEAYYDETGTGLEIMVPKHRVGPEEHEVRVCMRPPHLGDSDLV
LS*

Other information
Ka divergence:-0.182736KaKs divergence:-0.144823
GC content 1 (%):55GC content 2 (%):55GC content divergence:0
Length 1 (bp):1614Length 2 (bp):1629Length divergence:0.005
MFE 1 (kcal):-600MFE 2 (kcal):-640.4MFE divergence0.033