Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132116-GRMZM2G080588
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191291
Function (paralog2):serine/threonine-protein kinase Eg2-like

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAIATESRGCEDRDSAHANEEKRWVLSDFEVGKPLGRGKFGHVYLAREKRSNQIVALKVL
FKSQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQTRVYLILEYAAKGELYKELTR
CKHFSERRSATYIASLARALIYLHGKHVIHRDIKPENLLVGAQGEIKIADFGWSVHTFNR
RRTMCGTLDYLPPEMVEKTEHDYHVDIWSLGILCYEFLYGVPPFEAKEHSETYRRIVKVD
LKFPLKPFVSPAAKDLISQMLVKNSAQRLPLHKVLEHPWIVQNADPSGVCRG*

MAVATESRGSEDRASAHANQEKRWVLSDFEVGKPLGRGKFGHVYLAREKRSSEIVALKVL
FKSQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQTRVYLILEYAAKGELYKELTR
CKHFSERRTATYVASLARALIYLHGKHVIHRDIKPENLLVGVQGEIKIADFGWSVHTFNR
RRTMCGTLDYLPPEMVEKAEHDYHVDIWSLGVLCYEFLYGVPPFEAKEHSETYRRIVKVD
LKFPLKPFVSPAAKDLISQMLVKSSAQRLPLHKVLEHPWIVQNADPSGVYREGRSV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):879Length 2 (bp):891Length divergence:0.007
MFE 1 (kcal):-293.3MFE 2 (kcal):-314.4MFE divergence0.035