Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132169-GRMZM2G336337
Species:maize
Duplication type:WGD
Function (paralog1):L-ascorbate oxidase
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.539285421218
Log2 mRNA fold difference:-4.1058809128859
Log2 TE fold difference:0
Sequences
Protein sequence

MASSSSSRLLLLLLPCLALTLLGAADAEVHHHEFVIQETPVKRLCKTHNIITVNGQYPGP
TLEVREGDTLVINVVNRAQYNATIHWHGIRQIRTGWADGPEFVTQCPIRPGGSYKYRFTI
QGQEGTLWWHAHSSWLRATVYGALIIRPRENKTYPFAKPSREVPVILGEWWDANPIDVIR
EAQRTGGGPNVSDAFTINGQPGDLYKCSNKETTAIPVKAGETALLRFINAALNHELFVTI
AQHKMTVVATDASYTKPFTTSVLMLAPGQTTDVLVTMDQPPTRYYVAARAYVSGQNVAFD
NTTTTAVLEYDCGCASDFGPKIQPAFPAALPAFNDTSAATAFAAGIRSPDRVKVHENVDE
YLFFTVGLGLFNCKPGQLCAGPNNNTRFAASMNNVSFVFPQTDSLLHAHYYKIPGVFTTD
FPAYPPVQFDYTGQNVSQALWQPVPATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGY
DFFILAEGFGNFDPKKDVEKFNYVDPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDV
HITWGLAMAFLVEDGYGELQSLEPPPVDLPMC*

MTSPSSSSSWLLLLLSCLALALLAADAEVHHHEFVVQETPVKRLCKTHNVITVNGQYPGP
TLEVREGDTLVINVVNRAQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYKYRFTI
EGQEGTLWWHAHSSWLRATVYGALIIRPRENKTYPFAKPSREVPVILGEWWDANPIDVIR
EAQRTGGAPNVSDAFTINGQPGDLYKCSQKETTAIPVKPGETALLRFINAALNHELFVTI
AQHRMTVVATDASYTKPFTTSVLMVAPGQTTDVLVTMDQAPARYYVAARAYVSGQNVAFD
NTTTTAVVEYDCGCASDFGPKIQPAFPSLPAFNDTAAAAAFAAGIKSPGRVRVHESVDEH
LFFTVGLGLFNCEPGQLCAGPNNSTRFTASMNNVSFVFPRTDSLLHAHYFKTPGVFTTDF
PAHPPVQFDYTAQNVSQALWQPVPATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYD
FFILAEGFGNFDPEKDVDKFNYVVPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVH
ITWGLAMAFLVEDGYGELQSLEPPPVDLPMC*

Other information
Ka divergence:0.0770258KaKs divergence:0.00762195
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):1719Length 2 (bp):1716Length divergence:-0.001
MFE 1 (kcal):-691.09MFE 2 (kcal):-728.78MFE divergence0.027