Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132184-GRMZM2G150806
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381489
Function (paralog2):hypothetical protein LOC100279298

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.46746415995001
Log2 mRNA fold difference:-0.51570319034576
Log2 TE fold difference:0.053696959664097
Sequences
Protein sequence

MGLAPPELGQFDGWESSGEEERERERWGWCRRSRRGSSRRRAAPKGTDDDTAVDTGCCIR
LWPVGTCPPPPQRSKVDTSTSSASTHGAEKSTENGSRNQPVALVVSGSTTTSNAESSSSA
SKVGEEIKVASQLRKFAFNDLKCATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTG
LTVAVKTLNHDGLQGHKEWVAEVDFLGNLHHPNLVRLIGYCVEDDQRLLVYEFMPRGSLD
NHLFRRSLPLPWAIRMKVALGAAKGLAFLHEEAERPVIYRDFKTSNILLDAEYNAKLSDF
GLAKDGPVGDKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMMSGRRSMDK
NRPNGEHNLVEWARPLLGERQRFYKLIDPRLEGNFSVKGAQKAAQLARVCLSRDPKARPL
MSQVVEVLKPLQNLKDMASASYFFQTMQAERMAHSSSMNGRSSMNGGFKTQSPFGRHGQP
PPVRSLSDGPRASPFRYSPKPNVK*

MGLAPPELGQFDGWESSGEERERWGWCRRSRRGSSRRRADPKGADDDTAVSTGCCIRLWP
VGTCPPPPPPPPPRSKVDTSTSSASTHGAEKSTENGSRNQPVALVVSGSTTTSNAESSSS
ASKDGELIKVAFQLRKFAFNDLKCATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGT
GLTVAVKTLNHDGLQGHKEWVAEVDFLGNLHHPNLVKLIGYCVEDDQRLLVYEFMPRGSL
DNHLFRRSLPLPWAIRMKVALGAAKGLAFLHEEAESPVIYRDFKTSNILLDAEYNAKLSD
FGLAKDGPVGDKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMMSGRRSMD
KNRPNGEHNLVEWARPLLGERQRFYKLVDPRLEGNFSVKGAQKAAQLARACLSRDPKARP
LMSQVVEVLRPLQNLRDMASASYFYQTMHAERMAHSSSMNGRSSHGHGSSKAQSPFGRNG
QQQPVRSLSDGPRASPFRYSPKPNVK*

Other information
Ka divergence:0.538981KaKs divergence:0.547579
GC content 1 (%):56GC content 2 (%):57GC content divergence:0.009
Length 1 (bp):1515Length 2 (bp):1521Length divergence:0.002
MFE 1 (kcal):-615.5MFE 2 (kcal):-617.67MFE divergence0.002