Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132273-GRMZM2G320023
Species:maize
Duplication type:TD
Function (paralog1):disease resistance response protein 206
Function (paralog2):hypothetical protein LOC100382329

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.39583272387837
Log2 mRNA fold difference:1.1448064089566
Log2 TE fold difference:-0.23172252393256
Sequences
Protein sequence

MAAAVPLVLLLLPTTLMAASAASGGEKSTHIKLYWHDVVSGPSPTAVPVAQAAVTNTSKT
AFGMVVVIDDPLTEGPDLKSSKPLGRAQGTYVGAGKDELSLMMNMNFVFQAGEYNGSTVA
IMGRNAVFDAVREMAVVGGTGAFRMARGYAQARTHTFDLNTGDATVEYNLYIKH*

MAAAVPLLQLLILPLLVASAAGGGGGGEKSTHMKLYWHDVVSGPSPTAVQVARAAVTNTS
KTAFGAVVVIDDPLTEGPDLKSSKPLGRAQGTYIGAGKDELSLMMSMNFVFQAGKYNGST
VAIMGRNAVFDAVREMAVVGGTGAFRMARGYAQARTHALDLNTGDATVEYNLYIKH*

www.000webhost.com

Other information
Ka divergence:0.0510011KaKs divergence:-0.355837
GC content 1 (%):68GC content 2 (%):69GC content divergence:0.007
Length 1 (bp):525Length 2 (bp):531Length divergence:0.006
MFE 1 (kcal):-239.2MFE 2 (kcal):-251.4MFE divergence0.025