Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132489-GRMZM2G333478
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281459
Function (paralog2):disulfide oxidoreductase/ monooxygenase/ oxidoreductase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.70168404559533
Log2 mRNA fold difference:-1.0890145693335
Log2 TE fold difference:1.8627717377226
Sequences
Protein sequence

MEAADASSAPPPAEGRVVWVNGPIVVGAGPGGLSVAACLRARGVPCVVLDRADCIASLWQ
RRTYDRLRLHLPRQFCELPGMPFPDHYPEYPTKRQFVDYLQAYAERAGVQPRFNQAVTSA
RYDRAAGLWRVRAADALADDDVASAASTEYIGRWLVVATGENAERIVPEFDGAQDFAGPV
SHVSEYKCGEAYRGKRVLVVGCGNSGMEVCLDLCDHNALPSMVVRDAVHVLPREMFGVAT
FSVAVFLLRFLPLWLVDAVLVLLARLFLGDLEKLGIRRPAGGPLELKNARGRTPVLDIGA
LARIRSGHIQVVPGIKRFFRGGAELVDGRRVAADAVILATGYHSNVPQWLKGSDFFTQEG
YPRVPFPHGWKGESGLYSVGFTRRGLSGVSSDAVKVAQDIAVEWEKQTSTR*

MAAAASRTVWVNGPIVVGAGPAGLSVAACLRERGVPSVVLDRADCIASLWQRRTYDRLRL
HLPRRFCELPGMPFPAHYPEYPTKRQFVEYLQAYADRAGVEPRFNQAVTSARYDEAAGLW
RVRAEDVLASTSTTEYIGRWLVVATGENAERVVPEFEGARDFAGPVSHVAEYKCGEAYRG
KRVLVVGCGNSGMEVCLDLCDHGALPSMVVRGSVHVLPREMLGVATFSVAVFLLRFLPLR
LVDAVLVLLARLFLGDLERLGIRRPACGGPLQLKNARGRTPVLDIGALARIRSGHVRVVP
GIRRLFRGGAELQDGRRVAADAVILATGYHSNVPQWLKGSDFFTEEGYPRVAFPHGWKGE
SGLYSVGFTRRGLSGVSSDAVKVAQDIAVEWEKQTSKR*

Other information
Ka divergence:0.223144KaKs divergence:0.0987574
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):1236Length 2 (bp):1197Length divergence:-0.016
MFE 1 (kcal):-627.4MFE 2 (kcal):-630.9MFE divergence0.003