Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132780-GRMZM2G377165
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):C2H2 zinc-finger protein Fragment

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.2018544663567
Log2 mRNA fold difference:1.2078059769849
Log2 TE fold difference:1.0128855533449
Sequences
Protein sequence

MAEAADASPPPPTVGRGDRKRGRASPVLPPPPPGPPPPGPHKKRREEGGGGFDRRRLGPV
GGGGHEQDDRRYGNGLGGVGGRGGDGQYTNRAPDWSDSGRGGWNEGPGNSRREGLMSYKQ
FIQELEDDVSPVEAQSRYEGYKSEYITTQKKAYFDLHKNEDWLRNKYHPTNLENVIERRN
ELARTTANDFFLKLQSGDLDIGPGLTGSAVSKSGNNSSKNLDAVEGDGKKGKHGKGSDDS
YYAASKAHPVSSEVRRIRIDIEQAQVLIRKLDSEKGIENNVLSSSDHEKSDRDKSHGSVG
PIVIIQGSSTVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPKGLRHVKADARTYNGA
SSNGAEWENKLDSFWQDRIQGQDPLEMLKGKEKIDGAATEVLDPYVRKIRDEKYGWKYGC
GAKGCTKLFHAAEFVQKHLKLKHADLVVDLTSKVREDIYFENYMNDPKAPGGTPIMQQPA
PRGKGRQRPPIESRLRDERGNHRFDRNVDSPKRDGSGENPDDPIYDSFGDPAMHGAFPPD
IPAPPVLMPVPGAGPLGPFIPAPPEVAMHMLRDQGAPPPIEPTGGPHPRKAGTGGGPSMR
GPSPIFGAPSPHHMHDPRRIRSYQDLDAPEDEVTVMDYRSL*

MSYKQFIQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFALHKDEDWLRNKYHPTNLENV
IERRNELARTTADDFFLQLQSGSLDTGPGLTGSAVSKSGNNSSKNLDAVEGDGKKGKLGK
GSDDSYYAAPKAHPVSSEVRRIRIDIEQAQGLICKLDSEKGIENNILSSSNHEKPDMDKS
HGSMGPIVIVQGSSTVKGLEGTELLDTLVTYLWRIHGVDYYGMSETNEPKGLRHVKADAR
TYNGASSSATEWENKLDSFWQDRIQGQDPLEILKAKEKIDGAATEVLDPYVRKIRDEKYG
WKYGCGAKGCTKLFHAAEFVQKHIKLKHTDLVVDLTSKAREDIYFENYMNDPKAPGGTPI
MQQPAPRGKGRQRPPIESRLRDERGNHRLDSDGSGENPDDPVYDSFGDPTMHGAFPPDIP
APPVLMPVPGAGPLGPFIPAPPEVAMHMLRDQGAPPPFEPSGGPHPRKAGRGSGGGGPPM
RGPSPVFSAPPPHHMHDPRRIRSYQDLDAPEDEVTVMDYRSL*

Other information
Ka divergence:-0.12521KaKs divergence:-0.374486
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):1926Length 2 (bp):1569Length divergence:-0.102
MFE 1 (kcal):-662.88MFE 2 (kcal):-494.92MFE divergence-0.145