Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G132936-GRMZM2G056145
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279216

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAPKPIWVRQAEEAKLKSEAETAAAAKAAFDATFKALAAASGDDYNDVDPAPPSPAELT
STDSDDDAPALPGPVDPSKCSAAGPGIAGGSAGTPSTFTVVAKDRHSRRLTAGGARVHVR
VSPAAGVGGDDLEGTVKDNGDGSYTVTYVVPKRGNYMVHVELDGVSVMGSPFPVFFSGST
ATPSAAFPTALPAVSSAYPNMVNQTMPNMPNYTGAPSSAFPSLLGAMPSSTAGSSGGVIL
PGVGASLGEICRDYMNGRCTKVETDCKFTHPPQQLLMSLLAATTSVSALGHAPLAPSAAA
MAAAQAIMAAQALQAHAAQAKAAGGTSGSTNKADEADALKRTVQISNLSPLLTVDYIKQL
FGFCGKVVDCVMTDTKQIVYVEYSKPEEATAALELNSKSVGGRPLNVEMAKALPPKANNN
LPMMMQQAVQLQQIQFQQALMMQQSIAAQQAAARAATMKSATEAAAARAAEISRKLKAEG
FGGDNMEEKDAKGKSGSPSSPTRRSKSRSRSPIKYRRSRRSRSYSPPVGRSREHRSRSPS
RSRHSKHGSDRSHRDDKDMYSRSGRRESERSRDHHSSRSRRNRSKSRSPRHKKPSRVDSR
SPKKQRLESLSPSKSRSARAGSRSPRHHKGSKSSPTSDRHSRHSRHSRSRSLDRKHHHSD
KKDSRKSEIQDDRRSHRGSRRDKDESSVKDDGERSHRGSRRDKDESSVKDDGERSHRGSR
RNKDESSVKDDGERSHRGSRRDKDESSVKDDGERSHRGSRRGKDESSVKDDGERSHRGSR
LDKDESSVKDDGERSHRGSRRDKDESSVKDDGERSHRGSRRDKDENSVKDDGERSHRSSR
GDNDGRSVKDPVEDKRVDSNAVAHKRSSEDEILNNNSSNHKKHRHEVGLEVDEGNDVCPA
VADPNGKHETGVGGSLGGAAESAI*

MAAPKPIWVRQAEEAKLKSEAETAAAAKAAFEATFKALAAAPGDDDKDADPAPPSPAEPA
SPESDDDAPAPPGPVDPSKCSAAGPGIGGGSAGTPSTFTVVAKDRHSRRLTAGGALVRVR
VSPAAAVGGDDLEGAVKDNGDGSYTVTYVVPKRGNYMVHVDLDGAPVMGSPFPVFFSGST
VTPSAAFPTALPAVSSAYPNMVNQTMPNMPNYTGAPSSAFPSLLGAMPGSSAGSSSGVML
PGVGASLGEICRDYMNGRCTKVETDCKFTHPPQQLLMSMLAATSSVSALGHAPLAPSAAA
MAAAQAIMAAQALQAHAAQAKAAGGASGSVHKADEADALKRTVQISNLSPLLTVDYVKQL
FGLCGKVVDCTITDSKHIAYVEYSKPEEATAALEFNNKNVGGRPLNVEMAKSLPSKANNN
LPMMMQQAIQLQQMQFQQALMMQQSIATQQAAARAATMKSATEAAAARAAEISRKLKAEG
FGADNMEEKHAKGKSRSPSPSTRRSKSRSRSPIKYRRSRRSRSYSPPVRRSREQRSRSPS
KSRHSKYGSDRSHRDDKDRYSRSGRRESERSRDHHSSSSRRNRSKSRSPRHKKPSRVDSR
SPKKQREESLSPSKSRSARAGSRSPRHHKGSKSSPTRDRHSRHSRHSRSRSPGRKHRHSD
KRDSRKSEIQDDKRRSHRGSRHDKDESSVKDEGERSHRSNRGDKDERSVKDPVEDKGMDT
KVVAHKRSSTVSEDEILNNNSSNHKKYRHEVGLEVDGNDVCSAAADIDRKHETGVDGSLG
GAAESAM*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):2775Length 2 (bp):2364Length divergence:-0.08
MFE 1 (kcal):-977.3MFE 2 (kcal):-874.95MFE divergence-0.055