Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G133053-GRMZM2G403276
Species:maize
Duplication type:WGD
Function (paralog1):fasciclin-like arabinogalactan protein 8
Function (paralog2):hypothetical protein LOC100274174

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7584074879981
Log2 mRNA fold difference:-0.41604154475267
Log2 TE fold difference:-0.83391798469058
Sequences
Protein sequence

MRRAAAILLSLALAAAATTTAAAAVAKAPVPPPPPPPPPNVTAEMAKGGCKAFAGLIAAS
PDASSTYQSAVEGGMTVFCPSDDAVRAFLPKYRNLSADGKAELLLFHAVPVHYSLGSLKS
NNGPMNTLATDGAARNFNFTVQNRGDVVTIATAASAPARVKSTALDEDPLAIYVISAVVE
PVELFKPAPAPVPAPAPAPASVADAPRPGKAAAGRRHPPPAAADAPGPAAEDNAAPVDQK
DAKKSAAAGAPCALWWLAAALAAASALA*

MRRLSRAVAFLLLLLPLALAATTTMAAAVVAKAPAAAAAPPNVTAEMAKGGCKAFADLIA
ASPDASSTYQSAVEGGMTAFCPSDDAVRAFLPKYRNLSADGKAELLLFHAVPVHYSLGSL
KSNNGPMNTLATDGAARSFNFTVQSQGDAVTIRTAAAAAPARVESTVLDKDPLAIYVIDA
VVEPVELFKPAPSPSPTPAPAPAADAPKAGNGKAAARQRHPAPAVADAPGPAAEDDAAPV
DQKDVKKSAADGAPCSRWWLAAALAAASALV*

Other information
Ka divergence:0.0791101KaKs divergence:-0.273146
GC content 1 (%):75GC content 2 (%):73GC content divergence:-0.014
Length 1 (bp):807Length 2 (bp):816Length divergence:0.006
MFE 1 (kcal):-447.52MFE 2 (kcal):-429.11MFE divergence-0.021