Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G133173-GRMZM2G166855
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273881
Function (paralog2):hypothetical protein LOC100279928

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.721444787524
Log2 mRNA fold difference:-2.4553478759799
Log2 TE fold difference:0.73133912755641
Sequences
Protein sequence

MPQSPKPYTSLSATVIAIAMAGRRPAPVAILLLLAAAFAPISSAVRPVSDAHRSAAVELF
APSADGSFGDLESTYEAVRTFQILGLENYKSLSGKACKFAAENLASPGSTTKDLFHAVRI
SGALGCAVDAGVYDGVVARLKAVIQDTNSLLELYYPVGGLLGIKEQGHNVVLSDAEGTFH
ATKALSQSDGRWRYDTDSAESSTFAAGIALEALAGIVSLADAAVDPSMMGVVKNDVVKLF
DTIKSYNDGTFYFDEKHVDATEYKGPIITSASVVRGVTSFAAVVSGKLNIPAEKILGLAK
FFLGIGLPGSAKDCFNQIESLSFLENNRVFVPLILSLSSKVFSLTSKDQLKVEVTSVFGS
AAPSLKVNLVQVLGSDSKVITSENKELQYDLDNNVHYLDIAPLKIDVGKYSIVFEISLQE
PEQETVYATGGRNTESVIVTGLIKVDKAEIGISDNDAGAVESVQKLDLLKDTKVSLSANH
LQKLCLSFQLTTPLGHTFKPHQVFLKLRHESKVEHLFVVPGSARQFKIVLDFLGLVEKFY
YLSGRYDLELTVGDAVMENSFLRPLGHLELDLPDAPEKAPRPPAQAVDPFSKFGPKAEIS
HIFRAPEKRPPKELSLAFTGLTLLPFIGFLIGLVRLGVNLKNFPSLPGPAAFASLFHAGI
GAVLMLYVLFWIKLDLFTTLKYLGFLGIFLVFVGHRALSYLSSVSTKQKTA*

MAGRRPAPAALLLLAVAFAPISSAVRPVSDAHRSAAEELFAPSADGSFGDLESTYEAVKT
FQILGLEKYNSLSGKACKFAAENLASTDSTAKDLFHAVRISGALGCGVDAGVYDGVVARL
KAVIKDTNSLLEFYYSVGGLLSIKEQGHNVVLPDAESTFHAIKALSQSDGRWRYGTNSAE
SSTFAAGIALEALAGVVSLADAEVDPSMMVVVRNDIVKLFDTIKSYDDGTFYFDEKHVDA
TEYKGPIMTSASVVRGVTSFAAVASGKLDIPGDKILGLAKFFLGIGLPGSSKDCFNQIDS
LSVLEDNRVFVPLILSLPTKVFSLSLKDQLKVEVTTVFGSAAPLLKVNLVQVLGTDSKVI
TNGNRELQYDLDKNVHYLDIAPLEIDVGKYSVVFEISLQEQERETVYATGGRNTESVFVT
GLIKVDKAEIGISDNDAGTVESVQKLDLLKDTKVSLSANHLQKLRLSFQLTTPLGLTFKP
HQVFLKLKHESKVEHLFVVPGSARQFKIVLDFLGLVEKFYYLSGRYDLELAVGDAAMENS
FLRPLGHLELDLPEAPEKAPRPPAQAVDPFSKFGPKAEILHIFRAPEKRPPKELSLAFTG
LTLLPFIGFLIGLVRLGVNVKNFPSLPGPAAFASVFHAGIGAVLLLYVLFWLKLDLFTTL
KYLGFLGIFLVFVGHRTLSYLSSASAKQKTA*

Other information
Ka divergence:0.0676837KaKs divergence:-0.0485569
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2136Length 2 (bp):2076Length divergence:-0.014
MFE 1 (kcal):-716.7MFE 2 (kcal):-694.56MFE divergence-0.016