Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G133189-GRMZM2G379128
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100275269

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.414486738118
Log2 mRNA fold difference:-1.4725889934613
Log2 TE fold difference:0.46502397653247
Sequences
Protein sequence

MAECRSLIEFLRAFEHHRRAADISASACSRSRRAGASSAAGGSFCDSAPMAVVDAVMLLA
VVTALGFLLIPYLKLLLLEMGALLHPAASCLPAAAFFGAAVAVAAAVVAWELLGHHARKC
GKPRCRGLKKAVEFDIQLETEECVRGRPGPAARSALLAAAGARPVDLGDDQRELEAELRK
MAPPNGRTVLIFRAPCGCPKGRMEVWGAKKVRRIKK*

MAECRSLIEFLRAFEHHRRAADSSASACSRSRRASAAGGSFCDNTPMAVIDAVMLLAVVI
AIGFLLIPYLKLLLLEMGAMLHPAASCLPAAAFFGAAVAVAAVVVAWELLGHHARKCGKP
RCRGLKKAVEFDIQLETEECVRGRPGPTARSALLAAAGARPVELGDEQRELEAELRKMAP
PNGRTVLIFRAPCGCPKGRMEVWGAKKVRRIKK*

Other information
Ka divergence:0.314203KaKs divergence:0.0229008
GC content 1 (%):74GC content 2 (%):70GC content divergence:-0.028
Length 1 (bp):651Length 2 (bp):642Length divergence:-0.007
MFE 1 (kcal):-342.3MFE 2 (kcal):-325.9MFE divergence-0.025