Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G133400-GRMZM2G327686
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192831
Function (paralog2):hypothetical protein LOC100381563

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7513914330088
Log2 mRNA fold difference:-1.7212831842686
Log2 TE fold difference:0.025716431472134
Sequences
Protein sequence

MALLLLRGCAAPPAVHAAPAGSRLLPPALPRRRLVAVASSASPAPSGEVASSSQDGRGYG
TVGGPNGHAIAPATVTKSTAVETTVERVIFDFRFLALLAVAGSLAGSVLCFLNGCVFIKE
AYQVYWSSCVKGVHTGQMVLKVVEAIDVYLAGTVMLIFGMGLYGLFISNAPASVAPESDR
ALSGSSLFGMFALKERPKWMNITSLDELKTKVGHVIVMILLVKMFEKSKMVTIATGLDLL
SYSICIFLSSASLYILHNLHKGDHEE*

MALLVLRAPAAVHAASRLLPPQPRRRRRLVAVASAASSAPSGEVSSQHGGGGGGGYGIVG
GPNGNAVVPATKSTVVETTVERVIFDFRFLALLAVAGSLAGSLLCFLNGCVFIKEAYQVY
WSSCVKGVHTGQMVLKVVEAIDVYLAGTVMLIFGMGLYGLFVSNASAGVGSESDRALSGS
SLFGMFALKERPKWMKITSLDELKTIVGHVIVMILLVKMFERSKMVTIATGLDLLSYSIC
IFLSSASLYILHNLHKGDDHEE*

Other information
Ka divergence:-0.209094KaKs divergence:-0.467356
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):801Length 2 (bp):789Length divergence:-0.008
MFE 1 (kcal):-360.8MFE 2 (kcal):-359.61MFE divergence-0.002