Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134066-GRMZM2G008482
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277880
Function (paralog2):hypothetical protein LOC100277302

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASAGGRRRSKAKPRARAGGKAKKRTKYLSLTELLVKAHAQVGASPRSPWEDEEAVAAEV
KPEDDACGDDDDDHHHHHHEASTLFEAVPAPSLSDILGPSPPESPAGSGSGALPGAEEED
LPRRALRGRARERWVYCTGGPSPPPPATATGTATATASPCSSAASTGASPRSLLLKLDYD
EILAAWAGCGPLYIGAAVSPRPVLADAEVAVGRAERVRRYREKRRRRRLFFARRVRYEVR
RLNAVKRPRFKGRFIKEEERELRPAPA*

MARGQRRRRRRRPEPRARASGKGKKARYLSLSDLMVKAEVGATPPRSGCEEAGVKPEEED
ARGDGQQRQVEPFAPHHHHEASTLFEALPAPSLSDILGPSPSPSPDGAGSGASGLPGADE
EDLPRRALRGRERWVYCSGDSSFSPASTPPATATATTSSPSPPCSSSAASTGASARSLLL
KLDYEEILAAWADRGPLYIGAGSDLQLDAAQVASGRAERVRRYKEKRRRRLFAKRIRYEV
RRANAVKRPRFKVVTNSSPHVLSWDALQGRF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):74GC content 2 (%):73GC content divergence:-0.007
Length 1 (bp):804Length 2 (bp):816Length divergence:0.007
MFE 1 (kcal):-439.77MFE 2 (kcal):-448MFE divergence0.009