Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134130-GRMZM2G308944
Species:maize
Duplication type:WGD
Function (paralog1):photosystem II core complex proteins psbY
Function (paralog2):photosystem II core complex proteins psbY

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.30866519422891
Log2 mRNA fold difference:0.29133706180747
Log2 TE fold difference:-0.56503846673228
Sequences
Protein sequence

MATIATMALLKPAAKAAARSAPSTSSGSVSLRVRTGQAAKKAALSVSASSTLAGAFLAAL
ASSPDAALADVAAADAGGDSRGQLLLVVVAPAIGWVLYNILQPALNQLNRMRSSQAVAAG
LGLGAAAAAGMAAPPEASAAVVQDLAAIAAAAPADDSRGLLLLIVVAPAIGWVLFNILQP
ALNQLNRMRSD*

MATIATMALLKPARIVARSAPPSTSGSVSLRVPARAKKAAVSASVSSALAGAFFSALASS
DAALAAQRVADVAAAADSGSDNRGQLLLFVVAPAIGWVLYNILQPALNQLNRMRSQAVVA
GLGLGAAAAGMAAAPEASAAAAAQDLAALAAAAAAAAPADDNRGLLLLIVVTPAIGWVLF
NILQPALNQINRMKSD*

Other information
Ka divergence:-0.112627KaKs divergence:0.389675
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):576Length 2 (bp):591Length divergence:0.013
MFE 1 (kcal):-332.1MFE 2 (kcal):-334.24MFE divergence0.003