Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134134-GRMZM2G302259
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216648
Function (paralog2):Iron sulfur subunit of succinate dehydrogenasePutative uncharacterized protein Precursor ;

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.52145978093978
Log2 mRNA fold difference:-0.31367433316593
Log2 TE fold difference:-0.20020839293985
Sequences
Protein sequence

MAAAALLRRSPAARALLSPALSSRLVASKPHSSSPTQPPPEAKGASSTKTFSIYRWDPDS
PSTKPHLRDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGL
ACLTKISSASSASTVSPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDPPPQLGKEVPQ
TKADRAKLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRLPLWGTLMKPKPNMF
MHLQARGYHGVSEKRNLRDHKRRLLAEKFELRGKLYKAVCRDPDLPLDMREKFRYKLSKL
PRNSSMTRLRNRCIFTGRSRAVYKKFRMSRIVFRTLANKGELMGVKKASW*

MAAALLRRSPAVRALLSPALSSRLVASKPHSSSPAPPPPAKAASSTKTFSIYRWDPDSPS
TKPHLKDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLAC
LTKISGASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKRKDQPPQQGKEIPQTK
ADRAKLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRLPLWGTLIKPKPNMFMH
LQARGYHGVSEKRNLRDHKRRLLAEKYELRGKMYKAVCRDPDLPLDMREKFRYKLSKLPR
NSSMTRLRNRCIFTGRSRAVYKKFRMSRIVFRTLANKGELMGVKKASWWIQDSRDQFTKE
RLDAINDEFKLYRCHTIKNCTHACPKGLNPAKQIDTIKKLQLGAPSA*

Other information
Ka divergence:-1KaKs divergence:-0.041115
GC content 1 (%):61GC content 2 (%):61GC content divergence:0
Length 1 (bp):1053Length 2 (bp):1224Length divergence:0.075
MFE 1 (kcal):-393.89MFE 2 (kcal):-456.09MFE divergence0.073