Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134398-GRMZM2G161668
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284474
Function (paralog2):hypothetical protein LOC100280386

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.21122900777455
Log2 mRNA fold difference:0.95501901957872
Log2 TE fold difference:-0.74349412486829
Sequences
Protein sequence

MEAAPSLRTFSPSSFFSAGPRHCLLLAGPASRRARALPAPPLPRAVASTRAPLVVSSPPP
PAASGTTAPAHAKVDRSGRFCSPRAARELALMISYAACLEGTDVVRLFDRRISARREPGF
VFDKACLLSYNHMSFGGGPLEVGTEEEAEKLTSQNEKDSANEADVLSAPPKLVYNNFVLR
LSRELLVAVASGWDKHVEIIDKIIPQAWKDEPVARILELCILHIAMAEMTSKGTPHKVVI
NEAVDLAKRFCDGGAPRVINGCLRTFVKDHVDVAGTSQGAESKL*

MEAAPSARAFSPSSSPSAGARPSLPLAGLASRRARVLAAPPPPRAVASSRAPLVVSSPPP
PEDSGTHNPAHAKVDRSGRFCSPRAARELALMISYAACLEGTDVVRLFDRRISARREPGF
VFNKACLLNYNHMSFGGGPLEVGTEQEAEKLASQNDKDSANEADVLSAPPKLVYNNYVLR
LSRELLVAVASGWDKHVVIIDKIIPQAWKVRYLFLIFYVDSSIPSTCITASNYLYVQQSG
SNMYLFCILHHCFSHYTVLVNNHSDAYQKLFTVWFEHILILYITPLFFIALK*

Other information
Ka divergence:0.795291KaKs divergence:0.511294
GC content 1 (%):58GC content 2 (%):54GC content divergence:-0.036
Length 1 (bp):855Length 2 (bp):879Length divergence:0.014
MFE 1 (kcal):-327.82MFE 2 (kcal):-305.59MFE divergence-0.035