Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134450-GRMZM2G340578
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279327
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.34105137516653
Log2 mRNA fold difference:0.40660465796286
Log2 TE fold difference:-0.078673204270197
Sequences
Protein sequence

MALARGRLRARTAHAVASACFLVLLLLLLTSSSLFAPIGRSRAAEPDEGGTTVLGAAPSS
SSSSFSSSSLFGKGRGSSCEELQSISGGEGRCAYLRAHSPCSPAGYVDYLRLFYCGFAGA
PAAAACAALALWLVVLFYLLGDTASEYFCASLEGLSAALRLPPAVAGVTLLSLGNGAPDV
FASVVSFASGDGGGAGVGVGLSSALGGALFVSTVVAGAVALAAVGARGGVVVEWRGFVRD
ICFLLLALCYLLAVLVSGETTVWVAASFVSLYAGYVVLVWTSHCCAEKGKPAAAAGLSAP
LLHDDDDDGGGPSLPSHSSKTEGTSRARAMLHCVAGALCMPLYLPRRLTIPDIAGHRWSR
PYAVASAALAPVLLAFTWTSQRHNPLSSHSLAVLAGGALLGLLLAALAAATTDARSPPRG
RRRRVPWLAAGFVMSVLWAYTLARELVALLVAIGYVVGIKPSVLGVTVLAWGDSLGDLVS
NVAMAVHGGPGGAQTAVSGCYAGPLFNTVVGLGLSLALAAGAQHPAPFAVPADAAAYEAV
GFLGAALAWALFVVPVRGMRIDRVYGVGLIAIYLCFFAVRVLETLGLWS*

MALTRGRARTAPAVPSACFLLLLLLLLTSSSLLAAPTSGRAESGGGSVLGDASSSSGKAR
GDSCEELQSISGGEARCAYLRAQNSPCSPAGYVDYLRLFYCAFAGAPAAAACAALALWLA
VLFYLLGDTASEYFCASLEGLSAALRLPPAVAGVTLLSLGNGAPDVFASVVSFASGDDGG
GGVGLGSALGGALFVSTVVAGAVALAVGARGGAVVEWRGFVRDLCFLLLALCYLLAVLVH
GEVTVWVAASFVSLYVGYVVLVWTSHCCTEKGKPAADSLSAPLLLDDDDDVGDVVPSLPS
HTKTEASSTATSRVIATLHCLAAALCMPLYLPRRLTIPDIAGHRWSRPYAVASAALAPVL
IAVTWSSQRHNPTSWHGLAVLVGGALLGLLLAALAAATTDASSPPRGRRRRVPWLAAGFV
MSVLWAYTLARELVALLVAIGYVAGIKPSVLGVTVLAWGDSLGDLVSNVAMAVHGGPGGA
QTAVSGCYAGPLFNTVVGLGLSLALAAGAQHPAPFAVPVDAAAYEAVGFLGAALAWALFV
VPVRGMRIDRVYGVGLIAIYLCFFAVRVSETLGLWS*

www.000webhost.com

Other information
Ka divergence:0.086896KaKs divergence:-0.114591
GC content 1 (%):74GC content 2 (%):74GC content divergence:0
Length 1 (bp):1770Length 2 (bp):1731Length divergence:-0.011
MFE 1 (kcal):-1039.1MFE 2 (kcal):-988.63MFE divergence-0.025