Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134545-GRMZM2G064655
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100276996 (LOC100276996), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGAGGATAVKQPAAGAPDAGASRSGVGAGAAGAPVADPRAEALRCPRCDSANTKFCYYN
NYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSRSSGGPGAGGRNGSSAAAAAA
AAAAAVTSSSAPSTLSLPLHTGSLPSLSSALGLPGGASLASLLLGTAGSGGDHLGLFQAA
MQSVVSSEATAYEMQQQQQTQVDHLLGLGYGGAGAGAGAQIHLKPWMHEAPGAGAGGIMD
SFYAPLLSSSLVPGLEELHVKAEVAGAGDHQQKPAPGDQQSASWELPTPSSSNVDANVIA
SDALMAAAAASMNPGVSSATAATAPTVPSSFMYWGNGGIGGAAAAWPDLTNCGSSIATFF
*

MAGAGCATAVQRPAAAGAPAAVARTAVGAGGAVADPRAEALRCPRCDSANTKFCYYNNYS
LSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSSRSGGGGRNGSSSSFSSSSADSTA
LPLPPPPTTMGSLPSSLGLPGGASLLLGSALPGGAGDHHHLGLFQAAMQSVVSSDATAYD
EMQQQQQTQLDHLLGLGYGGGAGAQIQLKPWMQEAAGAGGAPGIMDSFYAPLLSSSLVPG
LEELHVKAEAAGAGDHQQKPSSRDQQSASWDWELPTPSSSNVDANVVTASDALMAAAAAA
SMNPAVSVSSTPSTAPTAPSSFLYWGNSGIGGAAAAWPDLANCGSSIATLF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):73GC content 2 (%):71GC content divergence:-0.014
Length 1 (bp):1083Length 2 (bp):1056Length divergence:-0.013
MFE 1 (kcal):-603.5MFE 2 (kcal):-555.43MFE divergence-0.041