Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134668-GRMZM2G022180
Species:maize
Duplication type:WGD
Function (paralog1):calnexin
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGGRALLLLLLVSALVFQIHASDPLLYEPFDEDFEGRWVVSKKDEYQGVWRHAKSDGHED
YGLLVSEKARKYAIIKELDEPVTLKDGTVVLQFEVRLQNGLECGGAYIKYIRPQDAGWDA
KEFDNETPYTIMFGPDKCGSTNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTA
ILKPDNEVKILVDGEEKKKANFLSADDFEPALIPSKTIPDPDDKKPEDWDERAKIPDPDA
VKPDDWDEDAPMEIVDDEATKPEGWLDDEPEEIDDPEAAKPEDWDDEEDGEWEAPKIDNP
KCEEAPGCGEWKRPMKQNPAYKGKWHAPMIDNPNYKGIWKPQEIPNPEYFELDKPDFDPI
AAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYDVEKEKEKAEEEAAAGADGL
SEFQKKIFDVLYKIADVPFLAPYKTKIIDVIEKGEKQPNITIGILVSVVVVFVTVLFKIL
FGGKKPVAPVKPAAEAKKPKATVTDGAGSSGDKDEKEDEKEETAGPRRRTRRET*

MMGGRALLLLLVSALLVQIRASDPLLYEPFDEDFEGRWIVSKKDEYQGVWKHAKSDGHED
YGLLVSDKARKYAIIKELDEPVTLNDGTVVLQFEVRLQNGLECGGAYIKYIRPQDAGWDA
KEFDNETPYTIMFGPDKCGSTNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTA
ILKPDNEVRILIDGEEKKKANFLSADDFEPALIPSKTIPDPDDKKPEDWDERAKIPDPDA
VKPDDWDEDAPMEIVDEEATKPEGWLDDEPEEIDDPEAAKPEDWDDEEDGEWEAPKIDNP
KCEEAPGCGEWKRPMKQNPAYKGKWHAPMIDNPNYKGIWKPQEIPNPEYFELDRPDFDPI
AAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYDVEKEKEKAEEAAAGADGLS
DFQKKIFDVLYKIADIPFLAPYKTKIIDVIEKGEKQPNITIGILVSVVIVFVTVLFKILF
GGKKPVAPVKPAAEAKKPKAAETDGAGSSGDKDEKEDEKDETGPRRRTRRET*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1605Length 2 (bp):1599Length divergence:-0.002
MFE 1 (kcal):-560.42MFE 2 (kcal):-531.8MFE divergence-0.026