Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G134735-GRMZM2G471635
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.8186456314755
Log2 mRNA fold difference:-1.7641732944664
Log2 TE fold difference:0
Sequences
Protein sequence

MDLDMLNSHPEAQLELMNAMLQLEQLAGFPLHDHGGAIMMAVPSTPPSPPPPPGMQQQAA
THHHHLSSVPRHMSAGATANNNGRAGVYDDHQYPRQVRVTAASSSSCSCNDGGSSGEISA
TAAAAVGSSSSSSAMREMVFRVAALQPVNIEPEMVRPPKRRNARISTDPQSVAARVRRER
ISERIRVLQRLVPGGTKMDTASMLDEAIHYVKFLKTQVQSLERAAAADARRPVPDNGGAA
PYSSARINGQW*

MDFDMLNSHPEAQLELMKAMLQLEQLTAFPLPDHGAMMMVPSTPPSPGMPQATTHHHYFS
SVPHHMSAGANGRGVYDDDHQYSQGTAAPCNGSARSSEYVAHAQGPVAGGGNSGESTAAT
SVGSSSSAMREMIFRVAALQPVNIDPEMVRPPKRRNVRISTDPQSVAARMRRERISERIR
ILQRLVPGGTKMDTASMLDEAIHYVKFLKTQVQSLERAAAASGRRPAAPAVADNGAMNGQ
W*

www.000webhost.com

Other information
Ka divergence:-0.401283KaKs divergence:-0.663081
GC content 1 (%):69GC content 2 (%):67GC content divergence:-0.015
Length 1 (bp):756Length 2 (bp):726Length divergence:-0.02
MFE 1 (kcal):-368.2MFE 2 (kcal):-346.2MFE divergence-0.031