Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G135038-GRMZM2G158248
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100383371

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.46605149746571
Log2 mRNA fold difference:1.4111286989092
Log2 TE fold difference:-0.93849471739346
Sequences
Protein sequence

MAAPAVASPSRATPTDIPTAAPSPASPPRRLASAPPAVDASGSSSPASAHSGDQLSAPDA
SSPLLASRSEEYRLLFRLPPDEVLVQDFNCAVQENILLQGHMYLFLHHICFYSNIFGYET
KKCPDIVPVFQKTIPLQEVTDVRKAKTAAIFHNAIEIVAGSRRHFFGSFLSRDEAYRIIV
DGWEQHVSDARLLLERQETKSASSSEENGYVVLEGTKESKQDGDLSLPDRSVNSTAVSSS
NADGGDSNINISKRFSEVEENGLEDNIVALNPFNLEPVDAPPSVPESYTMISESKFQVPV
EVLFNFLLSDGAFGFVDDFHTKCGDKEFSCSKWRTDEQGGLVRDVSFLHPIKIYLGAKFG
TCQEVQKLRLYKNRRLVIQTSQSIGDAPYGDHFTVEGIWDVEQDSLDENCCDLRIYINVA
FSKKTIFRGKIEQSTKDECREVFSLWIKLVCLFSYLKIFLSATFHLEGHDLLKQEYDRSK
GASSTPDSGVQPGATTNEESAVEVAVPVASILETRFGLPAGSCSPICDHHSSTNKTPPGP
NGSSWDLDGQFRVQQRKHRVGAEAPQLTKRGDAARGGTHGDDEARVCLAQVLPGETAEDA
GQHMTAARVHGTGARVRYANSEVYTNTIQYNPEVVFSVSSVVTDGTDANRERWIVVCRGI
CRKAELQDPGIAFDVNSWSFPIALG*

MASPTVASPTRASPADIPTAAPSSAPRPRRLASAPPAVYASASSSPASAYSGDQLSAPDA
SSPLLASRSEEYRLLFRLPPDEVLVQDFNCALQENILLQGHMYLFLHHICFYSNIFGYET
KKTIPLQEVTDVRKAKTAAIFSNAIEIVAGSRRHFFGSFLSRDEAYQIIVDGWEQHVSNA
RLLLERQETKSASSSEENGYVLLEGAKEPKQDEDSSPLDRSVNSTAVSSGSADGGDSNIN
ISRRFSNVEENGLEDNIITLNPFNLEPVDDTPSVPESYTSVTESKFQVPVEVLFNLLLSD
GAFGFLDDFHKNCGDKEFSCSKWRTDEQGGLVRDVSFLHPIKIYLGAKFGTCQEVQKLRL
YKNRRLVIQTSQSIGDAPYGDHFTVEGIWDVEQDSLDENCCYLRIYINVAFSKKTIFRGK
IEQSTKDECREVFSLWIKLGHDLLKQEYDRSKGTSSTTDSGAQSGAITNEENTGEVAVPM
VSTSQDVSGARSLIPPFQDPQQRTGRDSSIGSTSQELWGSLTSHMRSSQLGPVLAVALVA
IIVLLQVTIIVLLTRSPQVQMAPHGISTGSFGYSKESMEWAQKRLSLLREEMQVAEAHME
RMRHEFAWLRSYLEGLERLRRRT*

Other information
Ka divergence:-0.873221KaKs divergence:-0.475227
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2058Length 2 (bp):1872Length divergence:-0.047
MFE 1 (kcal):-710.21MFE 2 (kcal):-662.48MFE divergence-0.035