Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G135054-GRMZM5G809184
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):VPS28-like protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4792569372463
Log2 mRNA fold difference:2.4869496830245
Log2 TE fold difference:-1.021339469175
Sequences
Protein sequence

MEVKLWNDKRERELLESYADLYAIIKAVEKLERAYVRDLVSAADYEAECLKLISQFNSLS
SSLAGAVTVPRFVQAYRLDCPAALNRLLQSGVPATVELRAASASSAPAATAASASAIAHC
VQTFITAMDAVKLNMLANDQVRPLLQDVATSMARLGSLLPPDFEGKVKVNEWLAKLHKMG
AADELTEQQARQLNFDLDSAYSAFLAALPAAGL*

MEVKLWNDKRERELLESYADLYAIIKVTEKLERAYVRDLVSAADYEAECLKLISQFNSLS
SSLAGTVAVPRFVQAYRLDCPAALNRLLQSGVPATVELRAASASSAPAATSASAAAIAHC
VQTFITAMDAVKLNMLANDQVRPLLQDVATSMARLGSLLPPDFEGKVKVNEWLGKLHKMG
AADELTEQQARQLNFDLDSAYSAFLAALPAAGL*

Other information
Ka divergence:0.102572KaKs divergence:0.35773
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):642Length 2 (bp):642Length divergence:0
MFE 1 (kcal):-259.69MFE 2 (kcal):-266.63MFE divergence0.013