Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G135817-GRMZM2G143029
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.10748661523014
Log2 mRNA fold difference:1.028182704149
Log2 TE fold difference:-1.1235412647089
Sequences
Protein sequence

MEASAAEELAAAKRVIMRWDSTASAACSAGGDDQMLFDGAANRAEAERFLRAVDDLRRLA
PPSPASVGSPRRASAAGGVCDAVQVAMARLEDEFRHVLSARALDLEIEALAGLSSLSMAS
DRRNSDATEEAAAGDDDGSGGGGGSSVSSSVGRRSSYRSLQSIREIDLFPADAISDLHAI
AYRMAAAGYGRECVQVYASVRKPAVDSAMRRLGVEKLSIGDVQRLEWDSLEAKIRRWICA
ARAAVRGVFASERRLCFHIFHDLPLRTSTATAAYATNQDAPFAEAVKGAALQLFGFAEAI
SIGRRSTEKLFKIIDLHDALSDMLPDISDIFAASKATESIYVQAAEIRSRLADAVRGILS
EFENAVLRDPSKTPVPGGTIHPLTRYVMNYISLISDYKATLSELVISRPSASSRTAAEGN
EATPSFPDLDPPDPDSQLPLAAHLIWIIVVLEHNLESKASLYKDAALSHLFLMNNVHYIV
HKVKDSAELRGLIGNEYLKRLTGKFRQEATRYQRTAWLKILNCLRDEGLHVSGGFSSGIS
KSALRERFKAFNAAFEEAHRVQSAWYVPDTQLREELRISISEKLLPAYRSFLGRFRHHIE
NSRHPELYIKYSVEDLEITMADFFEGSPPPHNRRRSHG*

MEGFAAAELEAAERLVKRWDSTASAASSAGRGGDNQMLFDGAADRAEAERFLRAVDDLRR
LAPPSPASVGSPRRASSAGGVCTAVEVAMTRLEDEFRHVLSARALDLEIEALAGLSSLSM
ASGRSNSDATEAAAGEEDDGSVSSSVGRRSSYRSLQSIREIDLFPADAISDLHAIASRMA
AAGYGRECVQVYASVRKPAVDSALRRLGVEKLSIGDVQRLEWDALEAKIRRWIRAARAAV
RGVFASERCLCLHIFNDLPLRTSTATAAAAAAPTNHDAPFAEAVKGAALQLFGFAEAISI
GRRSPEKLFKIIDLHDALSDMLPDISDIFADSKAAESIYVQAAEIKSRLVDAVRGILSEF
ENAVLRDPSKTPVPGGTIHPLTRYVMNYSTLISDYKATLSELIISRPSASPQTAAEENEA
TPAFPDLDPPDPDSQLPLATHLVWIIVVLEHNLESKASLYKDAPLSHLFLMNNVHYIVHK
VKDSAELRGLIGDEYLRRLTGKFRQAATSYQRTAWLKILNCLRDEGLHVSGGFSSGVSKS
ALRERFKAFNAVFEEAHRVQSAWYVPDTQLREELRISVLEKLLPAYRSFLGRFRHHIENS
RHPELYIKYSVDDLEIAMADFFEGSPPSLHNRRRSHG*

Other information
Ka divergence:0.0859114KaKs divergence:0.0393531
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):1917Length 2 (bp):1914Length divergence:-0.001
MFE 1 (kcal):-874.2MFE 2 (kcal):-844.74MFE divergence-0.017