Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G135904-GRMZM2G306028
Species:maize
Duplication type:WGD
Function (paralog1):LOC100285952 (cl9707_1a), mRNA
Function (paralog2):LOC100279766

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.6214924204569
Log2 mRNA fold difference:-0.51094187944506
Log2 TE fold difference:-1.0416305492625
Sequences
Protein sequence

MGGGGAIVHGFRRWFHRRSEGSTSNSNQSSLAGEGEADDGSSDLEVIEDPDLLGLRAIRV
PKRKMPLPVESHRKNSVEMEFFTEYGEASQYQIQEVIGKGSYGVVAAAVDTRTGERVAIK
KINDVFEHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFQDIYVVFELMESDLH
QVIRANDDLTPEHHQFFLYQLLRALKYIHAANVFHRDLKPKNILANSDCKLKICDFGLAR
ASFNDAPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGK
NVVHQLDIITDLLGTPSSETLSRIRNEKARRYLSCMRKKYPVPFTHKFRHADPLALRLLE
RLLAFDPKDRPSAEEALADPYFASLANVEREPSRHPISKLEFEFERKKLAKDDVRELIYR
EILEYHPQMLEEYMKGGEQISFLYP

MPLPVESHRKDSVEMEFFTEYGEASQYQIQEVIGKGSYGVVAAAVDTRTGERVAIKKIND
VFEHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFQDIYVVFELMESDLHQVIK
ANDDLTPEHHQFFLYQLLRALKYIHAANVFHRDLKPKNILANSDCKLKICDFGLARASFN
DAPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVH
QLDIITDLLGTPSSETLSRIRNEKARRYLSCMRKKYPVPFTHKFRNADPLALRLLERLLA
FDPKDRPTAEEALADPYFASLANVEREPSRHPISKLEFEFERRKLAKDDVRELIYREILE
YHPQMLEEHMQGGEQISFLYPSGVDRFKRQFAHLEEHYSKGERGSPLQRKHASLPRERVV
VSKDGDTDQHINDQERSADSVARTTVSPPRSEDDDMSDVKSTSLSSRSYLKSASISASKC
VVATKKHPEDDGIAEEMEGAVNGLSEKVSRMHS*

www.000webhost.com

Other information
Ka divergence:-0.142552KaKs divergence:-0.230216
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):1335Length 2 (bp):1542Length divergence:0.072
MFE 1 (kcal):-466.54MFE 2 (kcal):-506.72MFE divergence0.041