Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G136085-GRMZM2G155783
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.028430783958068
Log2 mRNA fold difference:0.13497708515062
Log2 TE fold difference:-0.1926550286761
Sequences
Protein sequence

MLRSPGNSPRRLSPSPTPAPSTPRPASPPPSTAPSSKRRRSEVLDEDTYVAAIERIIERD
YFPDLPRLRDRLDWLQAVRSHDPLILRDAQLKILDRRRRAQRHAAGPVPTPTPATSTALR
SPSFLTTPAGSVAGGVGGPDADHDDDVAAALSLDGFFHRFTSEDNDSFSRILDKVNQRRR
ERYAHLLEPPPPVEAGTKPSEDAKRNRITDGYGTSGQPPSTLEGAKFTAKKLLMYYPADQ
GEAPLTEEERAERLRGMTKEINKSNTRLHGRATADDARPKEEEGAAILYALVASSTPGGM
AYHDPDKLKKYDLEDLRKTPNPFYLESDKKAGNGYSFVRTPSPAPGVDESPFMTWGEIDG
TPLRLDPDETPGGSERAHFKMPPPPARDIKAHLLSRDAARKIKERSKPFHRPPLPSPARG
VSASPRTLSPAAQKFVRNAISKSSKSSSAIDESLRASYRGSTPSASTPKSRFSRDPGLTS
RSPSTRQGSTPPW*

MLRSPGNSPRLLSPSPTPAPSTPRPASPPPSNAPSSKRRRSEVLDEDTYVAAIERIIERD
YFPDLPRLRDRLDWLQAVRSHDPLILRDAQLKILDRRRRAQRHAGGARPDADHDDDVAAA
VSLDGFFRRFTSEDNDSFSRILDKVNQRRRERYAHLLEPPPPAEAGSKPSEDAKRNRITD
GYGTSGQPPSTLEVAKFTAKNQLMYYPADQGEAPLTEEERAERLRGMTKEINKSNTRLHG
RATADDARPKEEEGAAILYALVAGSTPGGMAYHDPDKLKKYDLEDLRKTPNPFYLESDKK
AGNGYSFVRTPSPAPGVDESPFMTWGEIDGTPLRLDSDETPGGSERAHFKMPPPPARDVK
AHLLSRDAARKIKERSNTFHRPPLPSPARGVSASPRTLSRAAQKFVRNAISKSAKSSSAI
DESLRASYRGSTPSASTPKSRFSRDPGLASRSPSTR*

Other information
Ka divergence:0.12339KaKs divergence:-0.00645161
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):1482Length 2 (bp):1371Length divergence:-0.039
MFE 1 (kcal):-614.14MFE 2 (kcal):-568.81MFE divergence-0.038