Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G136266-GRMZM2G146020
Species:maize
Duplication type:WGD
Function (paralog1):transcription factor PosF21
Function (paralog2):hypothetical protein LOC100193330

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.84771953200612
Log2 mRNA fold difference:0.56300946070571
Log2 TE fold difference:-1.4033686169343
Sequences
Protein sequence

MYDTHHPHRTHPPTRPSAAHTHTHTHTHTLHASETTRRTAASRPPPPRPGACELALASLP
APTEMDPRFPLPAAAAPSTGGGGGARGHHRRAHSETFLSFHDADLLLDPDGDFFSDLDFP
SLSDDSPAASDPTPPPHPQQQPPQASPAPRPPGGTHTRSLSLDAAFFEGLAFQGPSGSAG
GGGGPGHKRSGSMDGDTSPFEGESALSSGLPDYAKKAMPAERIAELALIDPKRAKRILAN
RQSAARSKERKIMYTSELEKKVQTLQTEATTLSAQLTLLQRDTTGLTAENRELKLRLQSM
EEQAKLRDALNEALREEVQRLKIAAGQVGNMNGNPFNGGLQQQIPSYFVQQQQQQQTPYF
GGHQAQLHNQNQNHRHQISSNVGQTLSGQSLNDSMDFM*

MDPRFTLPAAIGGGAGRVHHRRAHSESFLCFSDADLLLDPDGDLSFSDLDFPSLSDDSPA
ASDPTPPPPLPQPAPAPRPAGGAHTRSLSLDAAFFEGLAFQGPSGSAGGGPGHKRSGSMD
GATSPFEGESALSSGLPDYAKKAMPAERIAELALIDPKRAKRILANRQSAARSKERKVKY
TSELEKKVQTLQTEATTLSAQLTLLQRDTTGLTAENRELKLRLQSMEEQAKLRDALNETL
REEVQRLKIAAGQVGNMNGNPFNGGLQQQIPSYFVQQQQMSYFGGHQAQAQHHSQNHHHR
SPSNGRQSPSDQSLNDSMDFV*

Other information
Ka divergence:-0.0844619KaKs divergence:-0.147295
GC content 1 (%):64GC content 2 (%):63GC content divergence:-0.008
Length 1 (bp):1197Length 2 (bp):966Length divergence:-0.107
MFE 1 (kcal):-482.9MFE 2 (kcal):-411.7MFE divergence-0.08