Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G136412-GRMZM2G149543
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382918
Function (paralog2):hypothetical protein LOC100382401

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.66020961570744
Log2 mRNA fold difference:0.036801683491634
Log2 TE fold difference:0.57696596873295
Sequences
Protein sequence

MAAEGSGVQETFEARVKRLFGSRLFDAVPDSSFPTASWSVAAGDVERHRWSKPSEARDAE
EEAAGEAGRGDTPCVSAFYDANGCLRGRRRRSRQEEFEGNLDDLDEDEEEDSERERNAAE
QDEEEGVRVNIGLDPTLDREEEEDKYDREAFGREEAADRVYMHDIMDAGINMSINSIVPD
LLDDSIEEVYRFRKDPRADMRAASARLREDGSTKDCDSHCPTQAKDFPSVVHTKKAVEED
NVKPILKRKESQADLKPRKRVRFDANVKDSELDTFEHDEDSPTVPQSMDVITEVESTSTL
SASPGVPDYVRNPSKYTRYNLDVPESNDGSNRTALADMHDLLARSYPNMIHSETPVEIPS
SVTFIPRKKSVDTMAVDEGPRAIDSNSSAIGMVAGASDEPDQCEMDEDDSKSPSMPQMHT
NSKASSRRYRSSRTDDDE*

MAAEGGGGQETFEARVKRLFGSRLFDAVPDSSFPTASWSVAAGDVERQRWAKPSEARDAE
EEAAGEAGRGDTPCASSFYDSNGCLRSRRRRSRQEEFEGDLDDLDEDEEEDGERGRATEQ
DEDEGVRVNIGLDPTLDREEEEDKYDREAFGREEAADRVYMHDIMDDGINMSINSIVPDL
LDDSIEGVYRFKKDPRADMRAASARLREDDGSAKDGDSHYATEAKDFLNVGIQTKKAVEE
VNVKPILKRKEEQADLKPRKRVRFDANVKDRESDMFERDEDSPMVPQSMEVVTGKESTPT
LSVSPGVPDYVRNPSKYTRYTLDVPESNDDSNRTALADLHDLLGRSDQNRIHSETAVEIP
SSVTFIPRKKSVDAMAVDDGPRAIDSNSSVIGLVAGASDEPDQCEMDEDDSNLSSTPQMH
TNSKANSRRYRSSRTDDDE*

Other information
Ka divergence:-0.163464KaKs divergence:-0.292791
GC content 1 (%):53GC content 2 (%):54GC content divergence:0.009
Length 1 (bp):1317Length 2 (bp):1320Length divergence:0.001
MFE 1 (kcal):-486.8MFE 2 (kcal):-521.96MFE divergence0.035