Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G136580-GRMZM2G459363
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.12543646438543
Log2 mRNA fold difference:0.54229499931424
Log2 TE fold difference:-0.54818761016552
Sequences
Protein sequence

MVQQQQHRIYILQFRKGETEQEVACKVSQPKGVGRRVMYYYQDYGSGGGGKSGKTVQPRA
LGVRRFLAMLLLSFLCVGTLFVAPVSFLSFVHSDEGGAAAAATAARGGVSGPCSAVGNNS
LCCDRTSERADICFARGDLRMHSASASFQLVSTGNSTPGERIRPYTRKWEANVMATIDEV
RLRRVAPGDAARCDVRHDVPAVVFSTGGYTGNVYHEFNDGILPLFVTARHLRRRVALVIL
EYHDWWMTKYGDVVSQLSEFPPIDFSADRRVHCFPEVIAGLRIHGELTVDPARTPERRGI
GDFRRFLDDAYRGRIEFLERLERRAARRRPHRHHRGGALVPRAPPAGPREAEAERRPRLV
IVSRTGSRVIENEADVAALAADVGFDVRVIRPDRTTELCKIYRELNASDAMVGVHGAAMT
HFLFMRPGKVFIQVVPLGTDWAAGAYYGDPAARMGLRYVGYKILPEESSLSREYPTGDPV
LTDPAGVAQRGWDVTKKVYLDRQNVRLDLARFREELVAAHRYLAAAGGRRRRPRAAETTK
ARNGFLTRPVAATAL*

MVQQQQQHRIYILQFRKGGPEQEVSCKVSQPKGGGRRPVMYYYQDHGSGGGKNGKKVQPR
ALGLRRFLGMLFLSFLCVGTLFVAPVSFLSFVHSDEGGSAAAAAAAAATAAVRGGVSEPC
SAVGNDSLCCDRTSERADICFAKGDVRMHSASASFQLVSAGNSSAAAEEEERIRPYTRKW
EANVMATIDEVRLRRVLPGDAARCDVRHDAPAVLFSTGGYTGNVYHEFNDGILPLFVTAH
HLRRRVVLVILEYHDWWMTKYGDVVSQLSAFPPIDFAADRRVHCFPELIAGLRIHGELTV
DPARTPEGKSIGDFRRLLDDAYRGRIGFLERLERRAARKRLRQRRHRRGGGGGAPPAPGG
PREDRPRLVIVSRTGSRVIENEADVAALAADVGFDVRVIRPERTTELCKIYRELNGSDAM
VGVHGAAMTHFLFMRPGKVFIQVVPLGTHWAAGAYYGEPAARMGLRYVGYRILPEESSLS
REYPTGDPVLTDPAGVAQRGWDVTKKVYLDRQNVRLDLARFREELVRAHRYLAGGGRERP
SDVVGRV*

www.000webhost.com

Other information
Ka divergence:0.248664KaKs divergence:-0.00493733
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1668Length 2 (bp):1644Length divergence:-0.007
MFE 1 (kcal):-897.58MFE 2 (kcal):-889.3MFE divergence-0.005