Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G136769-GRMZM2G170843
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382017
Function (paralog2):ubiquilin-1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.25518379014474
Log2 mRNA fold difference:-0.48073991045908
Log2 TE fold difference:0.2159643979015
Sequences
Protein sequence

MASGGEGAGSGESPPAASVEAAAGEATLHIRCANGSKFTVQTDLGATVGGFKEVVAGSCD
VPAPQQRLIYKGRILKDEQTLESYGVETDHTIHLVRGVAPPAASSAPAAASSLASSTLSS
VPAGGLGDLFPGVGAPGSGRSSGIFGPGFPELEQVEQHLSQNPNLMREIMNMPAMQNLMN
NPDLIRNMIMSNPQMREIMDRNPDLAHVLNDPSVLRQTLEAARNPEIMREMMRNTDRAMS
NIESSPEGFNMLRRMYETVQEPFLNATTMSGEGNTASNPFAALLGNQGSNQPGQGQPATY
TPTIGSESTTGTPAPNTNPLPNPWSTNAGSAQGATRSSGNTRTGASGHVGGTGATGGLGG
LGSPDLSSLLGGLAGSPRTGASGGLGGLGSPDLGNMLGGSPDVSLFSQMLQNPAMMQMMQ
SIMSDPQTMNQLLSFNPNARNLMESNPQMREIFQNPEFLRQLTSPETLQQLLLFQQSLLG
QLGQHQPNQGRNNSGSATGTPGNPSLDTLMSMLSGLGSGGGIGVPNTSNVPPEELYATQL
TQLQEMGFIDTAENIQALLATAGNVHAAVERLLGNLGQ*

MASGGEGAGSGESPPAASVEAAAVEATLHIRCANGSKFTVQTDLGATVGAFKEVLSGSCG
VPAPQQRLIYKGRILKDEQTLDSYGVETDHTIHLVRGVATPAASSAPAAANPLASFTPSS
GPAGGLGGLFPGVDAPGNDRPSGIFRPGFPELEQVEQHLSQNPNLMREIMNMPAMQNLMN
NPDLIRNMIMNNPQMREIMDRNPDLAHVLNDPSVLRQTLEAARNPEIMREMMRNTDRAMS
NIESSPEGFNMLRRMYETVQEPFLNATTMGGEGSTASNPFSALLGNQGSSQPGQGQPATN
APTTGSESTTGTPAPNTNPLPNPWSTNAGSAQGATRTPSGNARTGGVGGTGATGGLGGLG
SPELSSLLGGLAGSPRTGSAGGLGGSGSPDLGSMLGGSPDVSPFSQMLQNPAMIQMMQNI
MSDPQTMNQLLNLNPNARNLMESNTHMREMFQNPEFLRQLTSPETLQQLLSFQQTLLGQL
GQHQPSQGGNNAGSATGTRGNPSLDTLMSMLSGLGSGGGLGVPNTSSVPPEELYATQLTQ
LQEMGFIDTAENIQALVATAGNVHAAVERLLGNLGQ*

Other information
Ka divergence:0.0344453KaKs divergence:-0.246915
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1737Length 2 (bp):1731Length divergence:-0.002
MFE 1 (kcal):-642.48MFE 2 (kcal):-623.53MFE divergence-0.015