Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G137696-GRMZM2G158093
Species:maize
Duplication type:TD
Function (paralog1):LOC100280907
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.76810507741786
Log2 mRNA fold difference:-4.5050878510793
Log2 TE fold difference:5.2589986444919
Sequences
Protein sequence

MSRFFEKRWCNVTRCPPGYFKDESIDKILVPRMKKMPVKMFRSIRHTKDFDMSLNYDKAY
ELPPGIPSHKFAEYSVSGLTDASEKYAHRNLSAPIKANLHFSLSRSGIIALDRAEAVIEI
TEWVEVPKKILTPESNITNQNSSSKVGVANSTTDIKENLSSGSDNNSSTPINGSNVQEII
TEKVLKKRTFRVPLKVVEKTTGGGTILSKELYSEAKNRLEALDKKDAERRKTAELKNNLE
SYVYSMKEKLEESTDILTVSTEQERESFAEKLSKVQDWLYMDGEDAQANEFKERLGQLKA
IGEPILFRLSELKARPAACENARLYLDELQKIVNKWETNKQWLPKKRVDEVVSQAEKVKA
WLEEKENLQKNTPVYSSPVFTSEQVYEKVLDLQDKVSSVNRIPKPKPKAEKKIAEEEPAS
KGKTTSSESAPNEGEYTETSQEPKAREGDHSASANSSDLDPESHDEL*

MAQSCSWGILLAVLVAGLAAAVAVPPATAAVASIDLGSEWLKVAAVHLAPGRAPIAVATN
EMSKRKSPALAALADGNRLIGEEAAGITARHPSKVFARARDLLAKPFSYVQSVTESLFLP
YDLVPDARGAAAVRADDGQVYSLEEIVAMVLHYAAGLADAHVGAPVRDAVIAVPPYFGQA
ERRALTQATQLAGINVLALINEHAGAALQYGIDKDFSNASRHVIFYDMGAGSTYAALVCY
SAYNAKEFGKTVSVNQFQVKDVRWNSELGGVEMEMRLVNYFADQFNKQLGNVVDIRQSPK
AMAKLKKQVKRTKEILSANTAAPISVESLYNDVDFRSSITREKFEELCEDLWEQALTPVK
EVLTHSGMKIDDIYAVELIGGATRVPKLQAKLQEFLGRRGLDKHLDADEAIVLGASLHAA
NLSDGIKLNRKLGMIDGSTYALVLEIDGPGYFKDESIDQILVPRMKKMPIKMFRSIRHTK
DFDVSLNYDKAYELPPGIPSHKFAEYSVSGLTDASENTPIDEGNVQEIIAENVLKKRTFR
VPLKVVEKTTGAGTILSKELYSEAKNRLEALDKKDAERRKTAELKNNLESYIYSMKEKLE
ESTGILTVSTEQERESFAQKLSEVQDWLYMDGEDAQANEFKERLGQLKAIGDPILFRLSE
LKARPAACENARLYLDELQKRRGRRSRNEDSWSSRLFRSLSRAPHRERDRSEPRRGRHDD
RRSTTGGRRHLPDSLDDSLLQQNGSQQVSLDVFPDHVVPRQLVCIDGSASSGGGREQRHH
QFRGRGQSMSPSPRPRHDASPNSGMAMAARGRSRERMPRRRPGRRARSVPRCQHGTGLDS
TAGGSRCTSDARRDDLDSTHPPPPSPPAIGTTMSAGSTTPVCRFRPGCVYRRRSRSASHQ
ELQAATSFIDSISAPVAQPILRPQDQRYELPKKTQRSFMGRARTSTRKSARLAAIAWPRG
DIQSRARQVLMKRLGILPESGSNQRQNRATDEELKRYFSLFNGPLTHLATKALVALCGLD
DPNEAGLQSS*

Other information
Ka divergence:0.485529KaKs divergence:0.0234565
GC content 1 (%):41GC content 2 (%):55GC content divergence:0.146
Length 1 (bp):1404Length 2 (bp):3093Length divergence:0.376
MFE 1 (kcal):-372.84MFE 2 (kcal):-1204.09MFE divergence0.527