Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G137788-GRMZM2G158359
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0297808371156
Log2 mRNA fold difference:-1.153363774271
Log2 TE fold difference:0.22353990743485
Sequences
Protein sequence

MPFPTAFTARRRRHEGAAGRWCGLVVLVLMALEAGAAAETSPSDVAAMRAVAKALGADKT
LGWDVAGDPCSPKRWDGVSCDSSGRVTAIQVGARGLTGTLPPEVGDLTELTRLEVFDNKL
SGPLPLLPGLSSLQVLLAHNNSFASIPADFFKGLTGLTAVAIDYNPFASWTLPASLAACA
SLANFSAISANVSGTLPDFLGAMPALQRLSLSFNQLSGPVPASLAGAPLVQLWLNGAHLN
GSISFVSNMTSLEQLWLHSNEFTGPLPDFAGFDDLWDLQLRDNMLTGPVPESLFKLKALK
NVTLTNNLLQGPMPQIPNGLHADIEADTERFCVQEAGKPCNPLVSLLLEVAAGFMYPKAL
AEDWRGNDPCMFPGVTCIQGNITGLTFANKGLSGSISPAIGKISSLKVLDLANNNITGTV
PEEVAVLPLLTKIDLSNNNLYGKLPTFASKNVAVNTAGNPNIGKDAPAPTAGPGSSNNSP
SGGSSSGSSGNNGNGGSSSSSVGVIAGSVAGTVAGLGLVAALGFYCYKRKQKPFGRVQSP
HAMVIHPRHSGSDDMVKITVAGGNANGGARASETYSQASSGPRDIHVVESGNMVISIQVL
RNVTNNFSEDNILGRGGFGTVYKGELHDGTKIAVKRMEAGVMGNKGLNEFKSEIAVLTKV
RHRNLVSLLGYCLDGNERILVYEYMPQGTLSQHLFEWSENNLRPLEWKKRLSIALDVARG
VEYLHSLAQQTFIHRDLKPSNILLGDDMKAKVADFGLVRLAPDDGKCVSIETRLAGTFGY
LAPEYAVTGRVTTKADVFSFGVILMELITGRKALDETRPEDSMHLVTWFRRMQLNKETFR
KAIDPVIDLDEETYASVSTVSELAGHCCAREAHQRPDMGHAVNVLSTLSEVWKPTDPDSD
DSYGIDLNMTLPQALKRWQAFEDSSHFDGATSSFVASLDNTQTSIPTRPPGFAESFTSAD
GR*

MPFPTARWRRRREGTASRWCGILVLALVALAAGATAETSPLDVAAMRAVAKALGADKTLG
WDVAGDPCSPKRWDGVSCDSSGRVTAIQVGARGLTGTLPPEVGDLTELTRLEVFDNKLSG
PLPSLPGLSSLQVLLAHNSSFASIPSDFFKGLTGLTAVAIDYNPFASWSLPTDLAACASL
ANFSAVSANVSGTLPDFLGEMPALQRLSLSLNQLSGPVPASLAGAPLVQLWLNGAHLNGS
ISFVSNMTSLEQLWLHSNDFTGPMPDFSRFDNLWDLQLRDNELTGPVPESLFKLKALKNV
TLTNNLLQGPMPQIPNQLHADIKADSERFCVQEAGKPCDPRVSLLLEVAAGFMYPKALAT
DWKGNDPCVFPGVSCIQGNITELIFTNKGLSGSISPSIGKISSLKVLNLANNNITGTVPE
EVAALPSLTEVDLSNNNLYGKLPTFASKSAVVKTAGNPNIGKDAPAPTAGSGGSNDSLSG
GGSSGSIGNNGGSSPSSVGVIVGSVAGTVVGLGLVAALGFYCYKRKQKPFGRVQSPHAMV
IHPRHSGSDDMVKITVAGGNANDGARASETYSQASNGPRDIHVVESGNMVISIQVLRNVT
NNFSEENILGRGGFGTVYKGELHDGTKIAVKRMEAGVMGNKGLNEFKSEIAVLTKVRHRN
LVSLLGYCLDGNERILVYEYMPQGALSQHLFEWSEKNLRPLEWKKRLSIALDVARGVEYL
HSLAQQTFIHRDLKPSNILLGDDMKAKVADFGLVRLAPADGKCVSVETRLAGTFGYLAPE
YAVTGRVTTKADVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRTQLNKETFRKAID
PVIDLDEETYASVSTVSELAGHCCAREAHQRPDMGHAVNVLSTLSEVWKPADPDSDDSYG
IDLNMSLPQALKRWQAFEDSSHFDGATSSFVASLDNTQTSIPTRPPGFADSFTSADGR*

Other information
Ka divergence:0.303789KaKs divergence:0.0330144
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):2889Length 2 (bp):2877Length divergence:-0.002
MFE 1 (kcal):-1146.4MFE 2 (kcal):-1149.22MFE divergence0.001