Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G137839-GRMZM2G054300
Species:maize
Duplication type:WGD
Function (paralog1):ascorbate peroxidase
Function (paralog2):APx1 - Cytosolic Ascorbate Peroxidase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAKNYPTVSAEYSEAVDKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTM
KHQSELAHGANAGLDIAVRLLEPIKEEFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRE
DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT
TNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYAADEKAFFDDYKEAHL
KLSELGFADA*

MVQSCASKCASFLAARSLGLTATMHPTRSFPFSHQSSGPPSYKPPGSLSLLAAMAKNYPT
VSAEYSEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKCPAELA
HGANAGLDIAVRLLEPIKEEFPTLSYADFYQLAGVVAVEVTGGPEIPFHPGREDKPQPPP
EGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTTNPLVFD
NSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYAADEKAFFDDYKEAHLKLSELG*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):753Length 2 (bp):900Length divergence:0.089
MFE 1 (kcal):-317MFE 2 (kcal):-358.86MFE divergence0.062