Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G137965-GRMZM2G316113
Species:maize
Duplication type:WGD
Function (paralog1):nucleosome/chromatin assembly factor group C
Function (paralog2):nucleosome/chromatin assembly factor C

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.36040120223777
Log2 mRNA fold difference:0.15352136617737
Log2 TE fold difference:-0.43963603003222
Sequences
Protein sequence

MKERGGSRAAVDERYAQWKSLIPVLYDWFANHNLVWPSLSCRWGPQFEKATYKNRQRLYL
SEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPFVKKYKTIVHPGEVNRIREL
PQNSKIIATHTDSPDVLVWDVEAQPNRHAVLGASESRPDLILTGHQENAEFALAMCPAEP
YVLSGGKDKFVVLWSIQDHISALGDSSSSPGASGSKQSGKIANEKESPKVDPRGIFHGHD
STVEDVQFCPSSAQEFCSVGDDACLILWDARTGTDPAVKVEKAHSGDVHCVDWNPLDVNY
ILTGSADNSVRMWDRRNLGSGGAGSPIHKFEGHKAAVLCVQWSPDRASVFGSSAEDGFLN
VWDHEKVGKKKNSNVPAGLFFQHAGHRDKIVDFHWNSSDPWTIVSVSDDGESTGGGGTLQ
IWRMSDLIYRPEDEVLTELENFKAHLASCAPRN*

MAIFICIVASLFFSFFLLKKRLLYAVFVVSSENATVAELATTLQADLYQLQAAASFACRL
GWAVKLLDTDSVLRDSSTPALSNNILSDEVESSRTSVASEKSGHELLSSDSDGHKNSGMA
YVGFIVDANVTSYLMMGSLSPGLKSHAVTLYEAGKLGDSCKADLCNDLASLEGKRFEGVV
SVGRLASDRAGGARAAWGHGIGNPTIVNLVMSLPHLSLRRTDRHATRAPWTAAPAPPSIA
LVNPVMEGPSSPPRARRLPGSSPPSSPLGAWGFPGSSSPPVNKTKGNTTASYHLFPRLPF
LLLPCTATPNSKSEEEDSGTAALVEEEAVKQAEGFEAVEARAKNVDKFDLSYLDNQVFFW
SVRDIFNRDLLNKKACVITSQKIGGNRNSSGSCISRLFALDYICTQGDLALIDFIKEIPC
EPRVEVVLIDDAFVERKSMECLFQPNAYLGDEVIDCYINLIKAQKHLKCRSGGRVHIENA
FQFNFLKRDGDVEIKTEELYPIEDMTQICSAERRVLLYLDHDMVFIPINIRETHWYLAVI
HARNMEIQVLDSLATSQDRKNLTDSIKGLQRQIDMISQRKELKDHRWPNLQVASWPLREI
DMGYAKQTDSPSDVEILENPTDSKKRKLLHVLDDSEVVYEDEKGPITQADLQKWFVDDWD
KRTPVKVSNDVCTNDFLMVGLSTKDMLVTKVDSIFVLCDYIMTIEDDTTLEMTWVRSFNP
FKIEISVKDLQNILTINKDMTLRCFDMAVRLLANKESCRPKGEIINNRKHYMDMRFWVLM
PWKFNGCHALFVIDHVKKHVTFIDFTPTQNWCKHMPYKRFAEAIIMASKKYKIAYSKKRS
GWAEDIFKWEHTIQTGVPIDLRGCNTSYLVLQAMAMWGNDRRMKFVGEEAPLLSLLAAQG
LGLRDGRPTSASTLETVPWEWEVPQVLSSRRRRPPVSEMKERSGSRAAVDERYAQWKSLI
PVLYDWFANHNLVWPSLSCRWGPQFEKATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKP
RVAAAEHISQFNEEARSPFVKKYKTIVHPGEVNRIRELPQNSKIIATHTDSPDVLIWDVE
AQPNRHAVLGASESRPDLILTGHKENAEFALAMCPAEPYVLSGGKDKSVVLWSIQDHISA
LGDSSSSPGASGSKQSIKTANEKESPKVDPRGIFHGHDSTVEDVQFCPSSAQEFCSVGDD
ACLILWDARTGTAPAVKVEKAHSGDVHCVDWNPLDVNYILTGSADNSVRMWDRRNLGSGG
AGSPIHKFEGHKAAVLCVQWSPDRASVFGSSAEDGFLNVWDHEKVGKKKNSNVPAGLFFQ
HAGHRDKIVDFHWNSSDPWTIVSVSDDGESTGGGGTLQIWRMSDLIYRPEDEVLAELENF
KAHLASCAPKN*

Other information
Ka divergence:-0.0510452KaKs divergence:0.0587432
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1362Length 2 (bp):4176Length divergence:0.508
MFE 1 (kcal):-458.4MFE 2 (kcal):-1376.91MFE divergence0.5