Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G138165-GRMZM2G060327
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAPTAESSSPPPQRRPRTGPPPGLKNLSNTCYLNCVLQCLASTPPLATFCLASGHSDICK
KVSPNRDKECAFCVLERQIARLLRADAGALDSPAKVIRCMPLFAEHFRWGRQEDAHEFLR
YVVDACHTAGLRTRKLLLAKGANGNCGEDGRGQGACLVMRETFGGALLSQVKCLVCNRES
NKTDEIMDISLDLPGSSSVADALARFFKPEILEGANKYSCERCKTLTSAQKQMFMLRAPK
VLVIQLKRFEGINGGKINRNIEFKETLGISDCMYNKSQVKHQISIAYSLVFFLGMQTSVD
AKTICETNYLAVVGCSLI*

MAPTAEPSSRPPQWRPRTGPPPGLKNLGNTCYLNSVLQCLASTPPLATFCLASRHSNQCK
KVFPNRDNDCALCVLERQIARLLRADAGALDSPAKVIRCMPLFAEHFRWGRQEDAHEFLR
YVVDACHTADLRMRKGLRAAAASGNCGEDVRGQGVCLVMRETFGGALLSQVKCLECKGES
NKTDEIMDISLDLPGSSSVADALSRFFHPETLDGANKYCCESCKKLTSARKQMFMLRAPK
VLVIQLKRFEGINGGKINRNIEFKEALDLSDCMYNKNQVTHQIW

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):55GC content divergence:0.028
Length 1 (bp):957Length 2 (bp):852Length divergence:-0.058
MFE 1 (kcal):-359.5MFE 2 (kcal):-318.41MFE divergence-0.061