Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G138220-GRMZM2G171628
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191627
Function (paralog2):ATP synthase delta chain

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.3968790517594
Log2 mRNA fold difference:2.1869135880352
Log2 TE fold difference:0.20620212582044
Sequences
Protein sequence

MLRHAARRLVSRTAAAPTARRALVTAEVPAEAAEDSTFVEAWKKVAPNIEPPTTPLFLMQ
PRPPTPATIPTKLTVNFVLPYKSEIANKEVDMVIVPATTGQMGVLPGHVATIAELKPGVL
SVHEGNDVTKYFVSSGFAFVHANSIADIVAVEAVPVDQIDPAFVQKGLAEFTAKLGSAST
DLEKAEAQIGVDVHSALNAALTG*

MLRHAARRLVSRAVAPPTARRALATAEVPAEAVEDSTFVEAWKKVAPNIEPPATPLSLMQ
PRPPTPATIPTKLTVNFVLPYKSEIANKEVDMVIVPATTGQMGVLPGHVATIAELKPGVL
SVHEGNDVSKYFVSSGFAFVHANSIADIVAVEAIPVDQIDPALVQKGLAEFTAKLGSAST
DLEKAEAQIGVDVHSALNAALTG*

Other information
Ka divergence:0.111384KaKs divergence:-0.0610212
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):612Length 2 (bp):612Length divergence:0
MFE 1 (kcal):-232.5MFE 2 (kcal):-222.7MFE divergence-0.022