Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G138659-GRMZM2G138496
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382152
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAAKSGVDVETRDGGGGGSFSEERFVDKLNKLNNTTASIQTLSHWCIFHRKRARRIVDT
WEKHFSTATNDKKISFLFLSNDILQNSKRKGGDYVHEFWRVLPRLLKHFYENGGEEAKKL
VARLIGIWDDRKVFGTRIESLKDGIFGDNPPIFDHSGNNNNSNPSSNPLNSKVGRKDSST
VLKKLAVGGMPEKIVTAYQSVFDQHFDEDTALNKCKSTVSVLENLKKDIDLASTEGDPPA
STMISDLQEQETILKHCIAQLGSVDAARISLINQLKEALTEQESKSEVLRSQLQVARAEA
EHAIQLRQRFGGAVVANGTGSSSSPLLMSPQLQSLNPAPSLAPPIGAAGDEPKRTAAAMA
DKLASLSAPVQVLSSIFSSFVATHGASLSSMNSGSPPRDQLSGAPPGFQVEKRPRLERTV
LASDMGAPPFSMQAPRLQQPVGSMPTQAATQMNQAPGLFAPPPPPPLPPLLPPLLQQFGQ
SAGGMMGMGPFGMMAGSMPPPPPMSSIMPAGFPAPSGPPPPPLPPAQTQPQQQQQSPPQP
PAPQQSAGFFQTSAGMGYFPAVQVQQSPSAQRQ*

MSGAKAGVDVETRDGGAGGSFSEERLVDKLNKLNNTAASIQTLSQWCIFHRKRARRVVDT
WEKQFSSATKDKKISFLFLSNDILQNSKRKGGDYVHEFWRVLPRSLKHVYENGGEDGKKL
VARLIGIWDERKVFGTRIESLKYSIFGDNPPIFDNNGNKNNSNPGSNPLNSKVARKDSST
VLKKLTVGGMPEKIVTAYQSVLDQHFDEDTVLNKCKSTVSVLEKIKKDIEDASTKGDQPA
STMISDLPEQETILKQCIAQLESVYVVRILLINQLKEALVEQESKSEVLRSQLQVARSEA
EHAIQLRQRFDGAVVSNGTGSNSSLLMITPTEQTAAMIQGSGVRLTSPQLQSLNPATSLA
PTVSAVGDEPKRTAAAMADKLTSLSAPVQVLSSIFSSFVAEHGASLSSKNSGPASGELSG
EPPGFQIEKRPRLEKTVQASDMGAPPFPVQVPQLQQQTGAAPTQLPTQINQAPGPFAPPL
PSLLPPFLQQFGQSTGGMMGVGPFGMMSGSMPPPPPLPNIMPAGFPGPSGPPPPPLPPAQ
NQPQQQQQSPQAPQQSPTSAGFFQSSAGMGFFPPVQVQQSPSAQRQ*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):1722Length 2 (bp):1761Length divergence:0.011
MFE 1 (kcal):-591.7MFE 2 (kcal):-577.9MFE divergence-0.012