Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G138727-GRMZM2G060429
Species:maize
Duplication type:WGD
Function (paralog1):Glutelin-2 Precursor (Zein-gamma)(27 kDa zein)(Zein Zc2)(Alcohol-soluble reduced glutelin)(ASG)
Function (paralog2):Zein-beta Precursor (Zein-2)(16 kDa zein)(Zein Zc1)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRVLLVALALLALAASATSTHTSGGCGCQPPPPVHLPPPVHLPPPVHLPPPVHLPPPVHL
PPPVHLPPPVHVPPPVHLPPPPCHYPTQPPRPQPHPQPHPCPCQQPHPSPCQLQGTCGVG
STPILGQCVEFLRHQCSPTATPYCSPQCQSLRQQCCQQLRQVEPQHRYQAIFGLVLQSIL
QQQPQSGQVAGLLAAQIAQQLTAMCGLQQPTPCPYAAAGGVPH*

MKVLIVALALLALAASAASSTSGGCGCQTPPFHLPPPFYMPPPFYLPPQQQPQPWQYPTQ
PPQLSPCQQFGSCGVGSVGSPFLGQCVEFLRHQCSPAATPYGSPQCQALQQQCCHQIRQV
EPLHRYQATYGVVLQSFLQQQPQGELAALMAAQVAQQLTAMCGLQLQQPGPCPCNAAAGG
VYY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):67GC content divergence:-0.015
Length 1 (bp):672Length 2 (bp):552Length divergence:-0.098
MFE 1 (kcal):-290.3MFE 2 (kcal):-252.9MFE divergence-0.069