Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G138800-GRMZM2G159643
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283201
Function (paralog2):LOC100285365

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.002188941012274
Log2 mRNA fold difference:-0.38571792177546
Log2 TE fold difference:0.40037017260077
Sequences
Protein sequence

MAVKIYVVYYSMYGHVGKLAEEIKKGALSVEGVEAKIWQVPEILSEEVLGKMGAPPKPDV
PVITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGMFFSTGTQG
GGQETTPLTAITQLTHHGMVFVPVGYTFGAKLFGMDQVQGGSPYGAGTFAADGSRWPSEV
ELEHAFHQGKYFAGIAKKLKGSA*

MAVKVYVVYYSMYGHVGKLAEEIQKGASSVEGVEAKTWQVPETLPEEVLGKMGAPPKPDV
PVITPQELAEADGILFGFPTRFGMMAAQMKAFFDATGGLWREQSLAGKPAGVFFCTGSQG
GGQETTALTAITQLTHHGMVFVPVGYTFGAKLFGMDQVQGGSPYGAGTFAADGSRWPSEV
ELEHAFHQGKYFAGIAKKLKGSA*

Other information
Ka divergence:0.292963KaKs divergence:0.427403
GC content 1 (%):58GC content 2 (%):60GC content divergence:0.017
Length 1 (bp):612Length 2 (bp):612Length divergence:0
MFE 1 (kcal):-238.74MFE 2 (kcal):-258.6MFE divergence0.04