Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G139038-GRMZM2G179097
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.21683750450079
Log2 mRNA fold difference:0.41635674981233
Log2 TE fold difference:-0.6337079963827
Sequences
Protein sequence

MAAGRHGGYRDYEERERELDAEASRRSKEQHHHLGGRHRDVDRRRDGGRSRGGRDFANGH
GRRRSPPPRSRLAGRLGDREPGEVLSGSASDDSGGRSDRGRENGVRSSSREGDMVAGTGI
SSPIKKRKFSPIIWDRDSPKPPHSGAARDKKSVESVPSELPPPPPLPQDHIPLSLSVEKS
PMDVETTVGTESAEQLPEHEVNKVIEQEEDYPSPTMRNISTSRWAGANDDEEGGAAPMKK
RSVSPADSSVPGQWKRASPEPGEVSGGRAMSRSSDSGKIGNDEKEDSEVDKDDYMDVDRE
HASDSGTENCMSDTDSDNEMCRPETPEPERPPHRCINMLQGCRSVDEFERLNKINEGTYG
VVYRARDKKTSEIVALKKVKMEREREGFPLTSLREINILLSFHHPSIVDVKEVVVGSSLD
SIFMVMEYMEHDLKGVMETMKQPYTQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLL
NNRGELKICDFGLSRQYGSPLKPYTQLVVTLWYRAPELLLGTKEYSTAIDMWSVGCIMAE
LLAKEPLFNGKTEFEQLDKIFRTLGTPSEKIWPGYAKLPGVKVNFVKQPYNRLRDKFPAA
SFSGRPILSEAGFDLLNRLLTYDPDKRISADDALKHKWFSEVPLPKSKDFMPTFPALNEL
DRRTKRYLKSPDPLEEQRLKELQGNIGNRGLFG*

MAAGRHGGYRDYEARERELDAEASRRSKEQHHHLGGRHRDVDRHRDGGRSRGGRDFANGY
GRRRSPPPRSRLAGRLGDREPGEVLSGSASDDSGGRPHRGRENGVLSSGREGDVMAVTDD
SGGRSHRRRENGVLSSGRDGDVMAVTGISSPSKKRKFSPIIWDRDSPKPPHSDAARDKKA
VEPVPSELPPPPPLPPQDHITLRLAVEKSLMDIEPTVGTESAVQLLEHEVNKVTEQEEEY
ATMRNISTSRWAGANDDDDDGAAPVKKKSLSPADSSVAGQWKRASPEPGEVSGGRTMSRS
SDSGKMSNDEKEDFEANEDDYMDVDKGHASDSDTENRMSDTDSDNEIHRPETPEREKAPH
RCINMLQDCRSVDEFERLNKINEGTYGVVYRARDKKTSEIVALKKVKMEKEREGFPLTSL
REINILLSFHNPSIVDVKEVVVGSSLDSIFMVMEYMEHDLKGVMETMKQPYTQSEVKCLM
LQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFGLSRQYGSPLKPYTQLVVTLWY
RAPELLLGTKEYSTAIDMWSVGCIMAELLAKEPLFNGKTEFEQLDKIFRTLGTPNEKIWP
GYAKLPGVKVNFVKQPYNRLRDKFPAASFSGRPILSEAGFDLLNRLLTYDPDKRISADDA
LKHKWFSEVPLPKSKDFMPTFPALNELDRRSRRYLKSPDPLEEQRLKELQGNIGNHGLFG
*

Other information
Ka divergence:-0.0406278KaKs divergence:0.0491129
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2082Length 2 (bp):2163Length divergence:0.019
MFE 1 (kcal):-705.64MFE 2 (kcal):-733.44MFE divergence0.019