Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G139041-GRMZM2G116876
Species:maize
Duplication type:WGD
Function (paralog1):hydrolase, acting on ester bonds
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAVARRGPGARLLAALLLLALVVSGHCLDAHHRGLKRRRRKHEIHSPVKTVVVVVMENR
SFDHILGWLRRTRPDIDGLTGRESNRLNASDPASPEIFVTDEAGYVDSDPGHGFEDIREQ
IFGSADTSAVPPPMSGFAQNARGMGLGMPQNVMSGFKPDAVPIYASLADDFAVFDRWFAS
VPTSTQPNRLFVHSATSHGLTFNARKDLIHGFPQKTIFDSLEENGLSFGIYYQNIPATLF
YQSLRRLKHLIKFHQYSLKFKLHAKLGKLPNYVVIEQRYFDCEMFPANDDHPSHDVARGQ
RFVKEVYETLRASPQWNETALIITYDEHGGFYDHVPTPVVGVPQPDGIVGPDPYYFKFER
LGVRVPTFLISPWIEKGTVIHEPNGPQDTSQYEHSSIPATVKKLFNLHSNFLTKRDAWAG
TFESYFKIRKTPRTDCPEKLPEVTKSLRPFGPKEDSSLSEFQVELIQLASQLNGDHVLNT
YPDIGRTMTVGEANRYAEDAVARFLEAGRIALRAGANESALVTMRPALTSRASMSSGLSS
EL*

MFPANDDHPSHDVARGQRFVKEVYETLRASPQWNETALIITYDEHGGFYDHVPTPVVGVP
QPDGIVGPDPYYFKFERLGVRVPTFLISPWIDKGTVIHKPNGPQDTSQYEHSSIPATVKK
LFNLHSNFLTKRDAWAGTFENYFKIRRTPRTDCPEKLPEVTKSLRPFGPKEDSSLSEFQV
ELIQLASQLNGDHVLNTYPDIGRTMTVGEANRYAEDAVARFLEAGRIALRAGANESALVT
MRPALTSRASMSSGLSSEL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):51GC content divergence:-0.064
Length 1 (bp):1629Length 2 (bp):780Length divergence:-0.352
MFE 1 (kcal):-632.2MFE 2 (kcal):-262.8MFE divergence-0.413